Anti-Antithrombin III/ATIII antibody (ab180614)
Key features and details
- Rabbit polyclonal to Antithrombin III/ATIII
- Suitable for: WB
- Reacts with: Mouse, Rat
- Isotype: IgG
Overview
-
Product name
Anti-Antithrombin III/ATIII antibody
See all Antithrombin III/ATIII primary antibodies -
Description
Rabbit polyclonal to Antithrombin III/ATIII -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details
Unsuitable for: ICC/IF -
Species reactivity
Reacts with: Mouse, Rat
Predicted to work with: Sheep, Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human Antithrombin III/ATIII aa 33-185.
Sequence:HGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWE LSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQ QLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDK SLT
Database link: P01008 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180614 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500. Predicted molecular weight: 52 kDa.
|
Notes |
---|
WB
1/500. Predicted molecular weight: 52 kDa. |
Target
-
Function
Most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin. -
Tissue specificity
Found in plasma. -
Involvement in disease
Defects in SERPINC1 are the cause of antithrombin III deficiency (AT3D) [MIM:613118]. AT3D is an important risk factor for hereditary thrombophilia, a hemostatic disorder characterized by a tendency to recurrent thrombosis. AT3D is classified into 4 types. Type I: characterized by a 50% decrease in antigenic and functional levels. Type II: has defects affecting the thrombin-binding domain. Type III: alteration of the heparin-binding domain. Plasma AT-III antigen levels are normal in type II and III. Type IV: consists of miscellaneous group of unclassifiable mutations. -
Sequence similarities
Belongs to the serpin family. -
Post-translational
modificationsPhosphorylation sites are present in the extracelllular medium. -
Cellular localization
Secreted > extracellular space. - Information by UniProt
-
Database links
- Entrez Gene: 540261 Cow
- Entrez Gene: 11905 Mouse
- Entrez Gene: 100173818 Orangutan
- Entrez Gene: 304917 Rat
- Entrez Gene: 443407 Sheep
- SwissProt: P41361 Cow
- SwissProt: P32261 Mouse
- SwissProt: Q5R5A3 Orangutan
see all -
Alternative names
- ANT3_HUMAN antibody
- Antithrombin antibody
- Antithrombin III antibody
see all
Images
-
All lanes : Anti-Antithrombin III/ATIII antibody (ab180614) at 1/500 dilution
Lane 1 : Mouse plasma
Lane 2 : Rat plasma
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution
Predicted band size: 52 kDa
Observed band size: 58 kDa why is the actual band size different from the predicted?
Exposure time: 60 seconds
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab180614 has been referenced in 1 publication.
- Iba T et al. The Comparison of the Protective Effects of a- and ß-Antithrombin against Vascular Endothelial Cell Damage Induced by Histone in Vitro. TH Open 1:e3-e10 (2017). PubMed: 31249909