Overview

  • Product name

    Anti-Antithrombin III/ATIII antibody
    See all Antithrombin III/ATIII primary antibodies
  • Description

    Rabbit polyclonal to Antithrombin III/ATIII
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human Antithrombin III/ATIII aa 140-190 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    FDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNET Y


    Database link: P01008

  • Positive control

    • Mouse liver lysate; Mouse spleen tissue.
  • General notes

    Previously labelled as Antithrombin III.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 52 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin.
  • Tissue specificity

    Found in plasma.
  • Involvement in disease

    Defects in SERPINC1 are the cause of antithrombin III deficiency (AT3D) [MIM:613118]. AT3D is an important risk factor for hereditary thrombophilia, a hemostatic disorder characterized by a tendency to recurrent thrombosis. AT3D is classified into 4 types. Type I: characterized by a 50% decrease in antigenic and functional levels. Type II: has defects affecting the thrombin-binding domain. Type III: alteration of the heparin-binding domain. Plasma AT-III antigen levels are normal in type II and III. Type IV: consists of miscellaneous group of unclassifiable mutations.
  • Sequence similarities

    Belongs to the serpin family.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANT3_HUMAN antibody
    • Antithrombin antibody
    • Antithrombin III antibody
    • Antithrombin-III antibody
    • AntithrombinIII antibody
    • AT 3 antibody
    • AT III antibody
    • AT3 antibody
    • AT3D antibody
    • ATIII antibody
    • Heparin cofactor I antibody
    • MGC22579 antibody
    • Serine (or cysteine) proteinase inhibitor clade C (antithrombin) member 1 antibody
    • Serine cysteine proteinase inhibitor clade C member 1 antibody
    • Serine proteinase inhibitor clade C member 1 antibody
    • Serpin C1 antibody
    • Serpin family C member 1 antibody
    • Serpin peptidase inhibitor clade C (antithrombin) member 1 antibody
    • SERPINC1 antibody
    • THPH7 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse spleen tissue labeling Antithrombin III/ATIII with ab217183 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Anti-Antithrombin III/ATIII antibody (ab217183) at 1/300 dilution + Mouse liver lysate

    Secondary
    Goat anti-rabbit IgG (H+L), HRP conjugated at 1/5000 dilution

    Predicted band size: 52 kDa

References

ab217183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up