Overview

  • Product name

    Anti-Antizyme inhibitor 1 antibody
    See all Antizyme inhibitor 1 primary antibodies
  • Description

    Rabbit polyclonal to Antizyme inhibitor 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Antizyme inhibitor 1 aa 5-290. (Expressed in E.coli).
    Sequence:

    IDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQ WQNVVAQIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVP PENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELKKIARNHPNAKVLLH IATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKE SQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTGTEFQLEEVNHVISP LLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAK


    Database link: O14977

  • Positive control

    • WB: Recombinant human Antizyme inhbitor 1 protein; Pig liver lysate; HepG2 cell lysate. IHC-P: Human liver and stomach tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 50 kDa.

Target

Images

  • Anti-Antizyme inhibitor 1 antibody (ab231342) at 1 µg/ml + Recombinant human Antizyme inhibitor 1 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 50 kDa

  • All lanes : Anti-Antizyme inhibitor 1 antibody (ab231342) at 1 µg/ml

    Lane 1 : Pig liver lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 50 kDa

  • Paraffin-embedded human liver tissue stained for Antizyme inhibitor 1 using ab231342 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for Antizyme inhibitor 1 using ab231342 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up