Overview

  • Product name

  • Description

    Rabbit polyclonal to AP-B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human AP-B aa 502-578.
    Sequence:

    MKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPG NVKKLGDTYPSISNARNAELRLRWGQI


    Database link: Q9H4A4

  • Positive control

    • Human gallbladder tissue; RT-4 and U-251 MG cell lysates; Human liver and tonsil lysates; U-2 OS cells.
  • General notes

    Previously labelled as RNPEP. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 73 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • All lanes : Anti-AP-B antibody (ab220088) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 73 kDa

  • Immunohistochemical analysis of paraffin-embedded human gallbladder tissue labeling AP-B with ab220088 at 1/500 dilution.

  • Immunofluorecent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling AP-B with ab220088 at 4 µg/ml (green).

References

ab220088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up