Overview

  • Product name

    Anti-AP-Q antibody
  • Description

    Rabbit polyclonal to AP-Q
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human AP-Q aa 818-905. The exact sequence is proprietary.
    Sequence:

    IPYPIKDVVLCYGIALGSDKEWDILLNTYTNTTNKEEKIQLAYAMSCSKD PWILNRYMEYAISTSPFTSNETNIIEVVASSEVGRYVA


    Database link: Q6Q4G3

  • Positive control

    • Human placenta tissue.
  • General notes

    Previously labelled as Laeverin.

Properties

Applications

Our Abpromise guarantee covers the use of ab185345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Metalloprotease which may be important for placentation by regulating biological activity of key peptides at the embryo-maternal interface. On synthetic substrates it shows a marked preference for Leu-4-methylcoumaryl-7-amide (Leu-MCA) over Met-MCA, Arg-LCA and Lys-LCA. Cleaves the N-terminal amino acid of several peptides such as angiotensin-3, kisspeptin-10 and endokinin C.
  • Tissue specificity

    Specifically expressed in placenta and not in other tissues. Mainly found at the cell surface region of the extravillous trophoblasts. Detected on extravillous trophoblasts in the outer layer of the chorion laeve in the fetal membrane Not detected on either fetal amnionic epithelial cells or maternal decidual cells. Also detected in the migrating extravillous trophoblasts in the maternal decidual tissues (at protein level).
  • Sequence similarities

    Belongs to the peptidase M1 family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aminopeptidase Q antibody
    • AMPQ_HUMAN antibody
    • AP-Q antibody
    • APQ antibody
    • Aqpep antibody
    • CHL2 antigen antibody
    • FLJ90650 antibody
    • Laeverin antibody
    • LVRN antibody
    • MGC125378 antibody
    • MGC125379 antibody
    • RGD1562779 antibody
    see all

Images

  • Immunohistochemical analysis of Human placenta tissue labeling AP-Q with ab185345 at 1/500 dilution.

References

ab185345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Testis, postnatal day 8)
Permeabilization
Yes - 0.1% Triton X-100 in PBS
Specification
Testis, postnatal day 8
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 3% · Temperature: 20°C
Fixative
Paraformaldehyde

Mr. Bryan Niedenberger

Verified customer

Submitted Mar 02 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up