For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ap1m1-antibody-ab194384.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Interspecies Interaction Host Virus Interaction
Share by email

Anti-AP1M1 antibody (ab194384)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-AP1M1 antibody (ab194384)
  • Western blot - Anti-AP1M1 antibody (ab194384)

Key features and details

  • Mouse polyclonal to AP1M1
  • Suitable for: WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-AP1M1 antibody
    See all AP1M1 primary antibodies
  • Description

    Mouse polyclonal to AP1M1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human AP1M1 aa 1-74. (NP_115882).
    Sequence:

    MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPIL AHGGVRFMWIKHNNLYLVATSKKN


    Database link: Q9BXS5
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • U-2 OS cell lysate
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Microbiology
    • Interspecies Interaction
    • Host Virus Interaction
    • Signal Transduction
    • Protein Trafficking
    • Vesicle Transport
    • Adapters

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG - Isotype Control (ab37355)

Applications

Our Abpromise guarantee covers the use of ab194384 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 49 kDa.

Target

  • Function

    Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
  • Sequence similarities

    Belongs to the adaptor complexes medium subunit family.
    Contains 1 MHD (mu homology) domain.
  • Post-translational
    modifications

    Phosphorylation of membrane-bound AP1M1/AP1M2 increases its affinity for sorting signals.
  • Cellular localization

    Golgi apparatus. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
  • Target information above from: UniProt accession Q9BXS5 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 504310 Cow
    • Entrez Gene: 8907 Human
    • Entrez Gene: 11767 Mouse
    • Entrez Gene: 306332 Rat
    • Omim: 603535 Human
    • SwissProt: Q2KJ81 Cow
    • SwissProt: Q9BXS5 Human
    • SwissProt: P35585 Mouse
    • SwissProt: Q32Q06 Rat
    • Unigene: 71040 Human
    see all
  • Alternative names

    • Adaptor protein complex AP-1 mu-1 subunit antibody
    • Adaptor-related protein complex 1 mu-1 subunit antibody
    • AP-1 complex subunit mu-1 antibody
    • AP-mu chain family member mu1A antibody
    • Ap1m1 antibody
    • AP1M1_HUMAN antibody
    • AP47 antibody
    • CLAPM2 antibody
    • Clathrin adaptor protein AP47 antibody
    • Clathrin assembly protein complex 1 medium chain 1 antibody
    • Clathrin assembly protein complex 1 medium chain antibody
    • Clathrin assembly protein complex AP1 mu subunit antibody
    • Clathrin coat assembly protein AP47 antibody
    • Clathrin coat-associated protein AP47 antibody
    • CLTNM antibody
    • Golgi adaptor AP 1 47 kDa protein antibody
    • Golgi adaptor HA1/AP1 adaptin mu-1 subunit antibody
    • HA1 47 kDa subunit antibody
    • MU 1A antibody
    • Mu-adaptin 1 antibody
    • Mu1A-adaptin antibody
    see all

Images

  • Western blot - Anti-AP1M1 antibody (ab194384)
    Western blot - Anti-AP1M1 antibody (ab194384)
    Anti-AP1M1 antibody (ab194384) at 1/1000 dilution + recombinant mouse AP1M1 (immunogen) at 0.2 µg

    Predicted band size: 49 kDa



    Predicted MW of immunogen: 34.25 KDa

  • Western blot - Anti-AP1M1 antibody (ab194384)
    Western blot - Anti-AP1M1 antibody (ab194384)
    Anti-AP1M1 antibody (ab194384) at 1/500 dilution + U-2 OS cell lysate at 50 µg

    Predicted band size: 49 kDa

Protocols

  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab194384? Please let us know so that we can cite the reference in this datasheet.

    ab194384 has been referenced in 1 publication.

    • Liu B  et al. Lovastatin Inhibits HIV-1-Induced MHC-I Downregulation by Targeting Nef-AP-1 Complex Formation: A New Strategy to Boost Immune Eradication of HIV-1 Infected Cells. Front Immunol 10:2151 (2019). PubMed: 31572371

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab194384.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.