Anti-AP1M1 antibody (ab194384)
Key features and details
- Mouse polyclonal to AP1M1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-AP1M1 antibody
See all AP1M1 primary antibodies -
Description
Mouse polyclonal to AP1M1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant fragment (GST-tag) corresponding to Human AP1M1 aa 1-74. (NP_115882).
Sequence:MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPIL AHGGVRFMWIKHNNLYLVATSKKN
Database link: Q9BXS5 -
Positive control
- U-2 OS cell lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Whole antiserum -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab194384 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/1000. Predicted molecular weight: 49 kDa. |
Target
-
Function
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. -
Sequence similarities
Belongs to the adaptor complexes medium subunit family.
Contains 1 MHD (mu homology) domain. -
Post-translational
modificationsPhosphorylation of membrane-bound AP1M1/AP1M2 increases its affinity for sorting signals. -
Cellular localization
Golgi apparatus. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex. - Information by UniProt
-
Database links
- Entrez Gene: 504310 Cow
- Entrez Gene: 8907 Human
- Entrez Gene: 11767 Mouse
- Entrez Gene: 306332 Rat
- Omim: 603535 Human
- SwissProt: Q2KJ81 Cow
- SwissProt: Q9BXS5 Human
- SwissProt: P35585 Mouse
see all -
Alternative names
- Adaptor protein complex AP-1 mu-1 subunit antibody
- Adaptor-related protein complex 1 mu-1 subunit antibody
- AP-1 complex subunit mu-1 antibody
see all
Images
-
Anti-AP1M1 antibody (ab194384) at 1/1000 dilution + recombinant mouse AP1M1 (immunogen) at 0.2 µg
Predicted band size: 49 kDaPredicted MW of immunogen: 34.25 KDa
-
Anti-AP1M1 antibody (ab194384) at 1/500 dilution + U-2 OS cell lysate at 50 µg
Predicted band size: 49 kDa
Datasheets and documents
References (1)
ab194384 has been referenced in 1 publication.
- Liu B et al. Lovastatin Inhibits HIV-1-Induced MHC-I Downregulation by Targeting Nef-AP-1 Complex Formation: A New Strategy to Boost Immune Eradication of HIV-1 Infected Cells. Front Immunol 10:2151 (2019). PubMed: 31572371