Overview

  • Product name

  • Description

    Rabbit polyclonal to AP2B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human AP2B1 aa 658-712.
    Sequence:

    GGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGY VAPKA


    Database link: P63010

  • Positive control

    • U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 beta subunit acts via its C-terminal appendage domain as a scaffolding platform for endocytic accessory proteins; at least some clathrin-associated sorting proteins (CLASPs) are recognized by their [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. The AP-2 beta subunit binds to clathrin heavy chain, promoting clathrin lattice assembly; clathrin displaces at least some CLASPs from AP2B1 which probably then can be positioned for further coat assembly.
  • Sequence similarities

    Belongs to the adaptor complexes large subunit family.
  • Post-translational
    modifications

    Phosphorylation at Tyr-737 by SRC occurs at the plasma membrane in clathrin-coated vesicles (CCVs).
  • Cellular localization

    Cell membrane. Membrane > coated pit. AP-2 appears to be excluded from internalizing CCVs and to disengage from sites of endocytosis seconds before internalization of the nascent CCV.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adapter related protein complex 2 beta 1 subunit antibody
    • Adapter-related protein complex 2 beta subunit antibody
    • Adaptin, beta 2 (beta) antibody
    • Adaptor protein complex AP-2 subunit beta antibody
    • Adaptor related protein complex 2, beta 1 subunit antibody
    • ADTB2 antibody
    • AP-2 complex subunit beta antibody
    • AP105B antibody
    • AP2 BETA antibody
    • Ap2b1 antibody
    • AP2B1_HUMAN antibody
    • Beta adaptin antibody
    • Beta-2-adaptin antibody
    • Beta-adaptin antibody
    • Beta2 adaptin antibody
    • CLAPB1 antibody
    • Clathrin assembly protein complex 2 beta large chain antibody
    • Clathrin associated/assembly/adaptor protein, large, beta 1 antibody
    • DKFZp781K0743 antibody
    • Plasma membrane adaptor HA2/AP2 adaptin beta subunit antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-251 MG cells labeling AP2B1 with ab220778 at 4 μg/ml (green).

References

ab220778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up