Overview

  • Product name

    Anti-AP2M1 antibody [4F1B2]
    See all AP2M1 primary antibodies
  • Description

    Mouse monoclonal [4F1B2] to AP2M1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human, Monkey
    Predicted to work with: Mouse, Rat, Chicken, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human AP2M1 aa 298-435. Expressed in E.coli.
    Sequence:

    RTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKAS ENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPS GLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC


    Database link: Q96CW1

  • Positive control

    • WB: Recombinant human AP2M1 (aa298-435) protein; Human AP2M2 (aa298-435)-IgG-Fc-transfected HEK-293 cell lysate; COS-7, SK-BR-3, MCF7, T-47D and HEK-293 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab233712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/300 - 1/800. Predicted molecular weight: 50 kDa.

Target

  • Function

    Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 mu subunit binds to transmembrane cargo proteins; it recognizes the Y-X-X-Phi motifs. The surface region interacting with to the Y-X-X-Phi motif is inaccessible in cytosolic AP-2, but becomes accessible through a conformational change following phosphorylation of AP-2 mu subunit at 'Tyr-156' in membrane-associated AP-2. The membrane-specific phosphorylation event appears to involve assembled clathrin which activates the AP-2 mu kinase AAK1 (By similarity). Plays a role in endocytosis of frizzled family members upon Wnt signaling.
  • Sequence similarities

    Belongs to the adaptor complexes medium subunit family.
    Contains 1 MHD (mu homology) domain.
  • Cellular localization

    Cell membrane. Membrane > coated pit. AP-2 appears to be excluded from internalizing CCVs and to disengage from sites of endocytosis seconds before internalization of the nascent CCV.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adapter-related protein complex 2 mu subunit antibody
    • Adaptin mu 1 antibody
    • Adaptin-mu2 antibody
    • Adaptor protein complex AP 2 subunit mu antibody
    • Adaptor protein complex AP-2 subunit mu antibody
    • Adaptor related protein complex 2 mu 1 subunit antibody
    • AP 2 mu 2 chain antibody
    • AP-2 complex subunit mu antibody
    • AP-2 mu chain antibody
    • Ap2m1 antibody
    • AP2M1_HUMAN antibody
    • AP50 antibody
    • CLAPM1 antibody
    • Clathrin adaptor complex AP2 mu subunit antibody
    • Clathrin assembly protein complex 2 medium chain antibody
    • Clathrin associated/assembly/adaptor protein medium 1 antibody
    • Clathrin coat adaptor protein AP50 antibody
    • Clathrin coat assembly protein AP50 antibody
    • Clathrin coat associated protein AP50 antibody
    • Clathrin coat-associated protein AP50 antibody
    • HA2 50 kDa subunit antibody
    • mu2 antibody
    • Plasma membrane adaptor AP-2 50 kDa protein antibody
    see all

Images

  • Anti-AP2M1 antibody [4F1B2] (ab233712) at 300 cells + Recombinant human AP2M1 (aa298-435) protein

    Developed using the ECL technique.

    Predicted band size: 50 kDa

  • All lanes : Anti-AP2M1 antibody [4F1B2] (ab233712) at 1/300 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Human AP2M1 (aa298-435)-IgG-Fc-tranfected HEK-293 cell lysate

    Developed using the ECL technique.

    Predicted band size: 50 kDa

  • All lanes : Anti-AP2M1 antibody [4F1B2] (ab233712) at 300 cells

    Lane 1 : COS-7 (African green monkey kidney fibroblast-like cell line) cell lysate
    Lane 2 : SK-BR-3 (human mammary gland adenocarcinoma cell line) cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) cell lysate
    Lane 4 : T-47D (human ductal breast epithelial tumor cell line) cell lysate
    Lane 5 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate

    Developed using the ECL technique.

    Predicted band size: 50 kDa

References

ab233712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up