Overview

  • Product name

    Anti-AP4B1 antibody
  • Description

    Rabbit polyclonal to AP4B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human AP4B1 aa 201-500.
    Sequence:

    HHLLNRMSKLDQWGQAEVLNFLLRYQPRSEEELFDILNLLDSFLKSSSPG VVMGATKLFLILAKMFPHVQTDVLVRVKGPLLAACSSESRELCFVALCHV RQILHSLPGHFSSHYKKFFCSYSEPHYIKLQKVEVLCELVNDENVQQVLE ELRGYCTDVSADFAQAAIFAIGGIARTYTDQCVQILTELLGLRQEHITTV VVQTFRDLVWLCPQCTEAVCQALPGCEENIQDSEGKQALIWLLGVHGERI PNAPYVLEDFVENVKSETFPAVKMELLTALLRLFLSRPAECQDMLGRLLY


    Database link: Q9Y6B7-1

  • Positive control

    • WB: HepG2, U-251 MG and L02 whole cell lysate. IHC-P: Human testis and adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.
  • Cellular localization

    Golgi apparatus, trans-Golgi network.
  • Database links

  • Alternative names

    • Adapter related protein complex 4 beta 1 subunit antibody
    • AP 4 adapter complex subunit beta antibody
    • AP 4 complex subunit beta 1 antibody
    • Beta subunit of AP 4 antibody

Images

  • All lanes : Anti-AP4B1 antibody (ab235539) at 1/500 dilution

    Lane 1 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) whole cell lysate
    Lane 3 : L02 (Human immortal liver cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human testis tissue stained for AP4B1 with ab235539 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for AP4B1 with ab235539 at 1/100 dilution in immunohistochemical analysis.

References

ab235539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up