Overview

  • Product name

    Anti-APAF1 antibody [2H9A1]
    See all APAF1 primary antibodies
  • Description

    Mouse monoclonal [2H9A1] to APAF1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human APAF1 aa 1138-1237. (Expressed in E.coli).
    Sequence:

    DSTLLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSP DGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDN


    Database link: O14727

  • Positive control

    • WB: Recombinant human APAF1 (AA: 1138-1237) protein and APAF1 (AA: 1138-1237)-hIgGFc transfected HEK-293 whole cell lysate. ICC/IF: HeLa cells. FC: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
ICC/IF 1/100 - 1/500.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Oligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP. Isoform 6 is less effective in inducing apoptosis.
  • Tissue specificity

    Ubiquitous. Highest levels of expression in adult spleen and peripheral blood leukocytes, and in fetal brain, kidney and lung. Isoform 1 is expressed in heart, kidney and liver.
  • Sequence similarities

    Contains 1 CARD domain.
    Contains 1 NB-ARC domain.
    Contains 13 WD repeats.
  • Domain

    The CARD domain mediates interaction with APIP.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • APAF 1 antibody
    • Apaf-1 antibody
    • APAF_HUMAN antibody
    • Apaf1 antibody
    • Apoptotic peptidase activating factor 1 antibody
    • Apoptotic protease activating factor 1 antibody
    • Apoptotic protease activating factor antibody
    • Apoptotic protease-activating factor 1 antibody
    • CED 4 antibody
    • CED4 antibody
    • KIAA0413 antibody
    see all

Images

  • Anti-APAF1 antibody [2H9A1] (ab233786) at 1/500 dilution + Recombinant human APAF1 (AA: 1138-1237) protein

    Developed using the ECL technique.


    Expected MW is 37 kDa.

  • All lanes : Anti-APAF1 antibody [2H9A1] (ab233786) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : APAF1 (AA: 1138-1237)-hIgGFc transfected HEK-293 whole cell lysate

    Developed using the ECL technique.
  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for APAF1 (green) using ab233786 at 1/100 dilution in ICC/IF.

    Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling APAF1 with ab233786 at 1/200 dilution (green) compared with a negative control (red).

References

ab233786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up