APC Anti-DEP1 antibody [MEM-CD148/05] (ab234278)
![Flow Cytometry - APC Anti-DEP1 antibody [MEM-CD148/05] (ab234278)](https://www.abcam.com/ps/products/234/ab234278/Images/ab234278-308334-2342781.jpg "Flow Cytometry - APC Anti-DEP1 antibody [MEM-CD148/05] (ab234278)")
Key features and details
- APC Mouse monoclonal [MEM-CD148/05] to DEP1
- Suitable for: Flow Cyt
- Reacts with: Human
- Conjugation: APC. Ex: 645nm, Em: 660nm
- Isotype: IgG2b
Overview
-
Product name
APC Anti-DEP1 antibody [MEM-CD148/05]
See all DEP1 primary antibodies -
Description
APC Mouse monoclonal [MEM-CD148/05] to DEP1 -
Host species
Mouse -
Conjugation
APC. Ex: 645nm, Em: 660nm -
Tested applications
Suitable for: Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human DEP1 aa 1-444.
Sequence:MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVAT VATGENGITQISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPE QGSNGTDGASQKTPSSTGPSPVFDIKAVSISPTNVILTWKSNDTAASEYK YVVKHKMENEKTITVVHQPWCNITGLRPATSYVFSITPGIGNETWGDPRV IKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLLESIGSHEELT QDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAA NGTEGQPQAIEFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYK IHVAGETDSSNLNVSEPRAVIPGLRSSTFYNITVCPVLGDIEGT
Database link: Q12913 -
Positive control
- Flow Cytometry: Human peripheral blood.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Do Not Freeze. Store In the Dark. -
Storage buffer
pH: 7.4
Preservative: 0.0975% Sodium azide
Constituent: PBS -
Concentration information loading... -
Purity
Size exclusion -
Purification notes
ab234278 is conjugated with cross-linked Allophycocyanin (APC) under optimum conditions. The conjugate is purified by size-exclusion chromatography and adjusted for direct use. -
Clonality
Monoclonal -
Clone number
MEM-CD148/05 -
Isotype
IgG2b -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab234278 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| Flow Cyt | Use 10µl for 106 cells. |
Target
-
Function
Tyrosine phosphatase which dephosphorylates or contributes to the dephosphorylation of CTNND1, PDGFRB, MET, RET (variant MEN2A), KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1 and PIK3R2. Plays a role in cell adhesion, migration, proliferation and differentiation. Involved in vascular development. Regulator of macrophage adhesion and spreading. Positively affects cell-matrix adhesion. Positive regulator of platelet activation and thrombosis. Negative regulator of cell proliferation. Negative regulator of PDGF-stimulated cell migration; through dephosphorylation of PDGFR. Positive regulator of endothelial cell survival, as well as of VEGF-induced SRC and AKT activation; through KDR dephosphorylation. Negative regulator of EGFR signaling pathway; through EGFR dephosphorylation. Enhances the barrier function of epithelial junctions during reassembly. Negatively regulates T-cell receptor (TCR) signaling. Upon T-cell TCR activation, it is up-regulated and excluded from the immunological synapses, while upon T-cell-antigen presenting cells (APC) disengagement, it is no longer excluded and can dephosphorylate PLCG1 and LAT to down-regulate prolongation of signaling. -
Tissue specificity
Expressed in the promyelocytic cell line HL60, the granulocyte-macrophage colony-stimulating factor-dependent leukemic cell line F-36P, and the interleukin-3 and erythropoietin-dependent leukemic cell line F-36E. Expressed predominantly in epithelial cells and lymphocytes. Enhanced expression at high cell density. -
Sequence similarities
Belongs to the protein-tyrosine phosphatase family. Receptor class 3 subfamily.
Contains 9 fibronectin type-III domains.
Contains 1 tyrosine-protein phosphatase domain. -
Post-translational
modificationsN- and O-glycosylated. -
Cellular localization
Cell membrane. Cell projection > ruffle membrane. Cell junction. After T cell stimulation, it is temporarily excluded from immunological synapses. - Information by UniProt
-
Database links
- Entrez Gene: 5795 Human
- Omim: 600925 Human
- SwissProt: Q12913 Human
- Unigene: 318547 Human
-
Alternative names
- CD 148 antibody
- CD148 antibody
- CD148 antigen antibody
see all
Images
-
Flow Cytometry - APC Anti-DEP1 antibody [MEM-CD148/05] (ab234278)
Flow cytometric analysis of human peripheral blood labeling DEP1 using ab234278 at 10 μl/106 cells. Surface staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab234278 has not yet been referenced specifically in any publications.
