APC Anti-FOXP3 antibody [3G3] (ab200568)
Key features and details
- APC Mouse monoclonal [3G3] to FOXP3
- Reacts with: Mouse, Human
- Conjugation: APC. Ex: 645nm, Em: 660nm
- Isotype: IgG1
Overview
-
Product name
APC Anti-FOXP3 antibody [3G3]
See all FOXP3 primary antibodies -
Description
APC Mouse monoclonal [3G3] to FOXP3 -
Host species
Mouse -
Conjugation
APC. Ex: 645nm, Em: 660nm -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cynomolgus monkey -
Immunogen
Recombinant full length protein (His-tag) corresponding to Mouse FOXP3 aa 1-429.
Sequence:MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDL RSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH FMHQLSTVDAHAQTPVLQVRPLDNPAMISLPPPSAATGVFSLKARPGLPP GINVASLEWVSREPALLCTFPRSGTPRKDSNLLAAPQGSYPLLANGVCKW PGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKE KLGAMQAHLAGKMALAKAPSVASMDKSSCCIVATSTQGSVLPAWSAPREA PDGGLFAVRRHLWGSHGNSSFPEFFHNMDYFKYHNMRPPFTYATLIRWAI LEAPERQRTLNEIYHWFTRMFAYFRNHPATWKNAIRHNLSLHKCFVRVES EKGAVWTVDEFEFRKKRSQRPNKCSNPCP
Database link: Q99JB6 -
Epitope
The mouse monoclonal antibody 3G3 recognizes the N-terminal region of FOXP3. -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Do Not Freeze. Store In the Dark. -
Storage buffer
pH: 7.40
Preservative: 0.098% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Size exclusion -
Purification notes
ab200568 is conjugated with Allophycocyanin (APC) under optimum conditions. The conjugate is purified by size-exclusion chromatography and adjusted for direct use. -
Clonality
Monoclonal -
Clone number
3G3 -
Isotype
IgG1 -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
Target
-
Function
Probable transcription factor. Plays a critical role in the control of immune response. -
Involvement in disease
Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) [MIM:304790]; also known as X-linked autoimmunity-immunodeficiency syndrome. IPEX is characterized by neonatal onset insulin-dependent diabetes mellitus, infections, secretory diarrhea, trombocytopenia, anemia and eczema. It is usually lethal in infancy. -
Sequence similarities
Contains 1 C2H2-type zinc finger.
Contains 1 fork-head DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 102120882 Cynomolgus monkey
- Entrez Gene: 50943 Human
- Entrez Gene: 20371 Mouse
- Omim: 300292 Human
- SwissProt: Q6U8D7 Cynomolgus monkey
- SwissProt: Q9BZS1 Human
- SwissProt: Q99JB6 Mouse
- Unigene: 247700 Human
see all -
Alternative names
- AIID antibody
- DIETER antibody
- Forkhead box P3 antibody
see all
Datasheets and documents
References (0)
ab200568 has not yet been referenced specifically in any publications.