APC Anti-Tissue Factor antibody (ab231522)
Key features and details
- APC Guinea pig polyclonal to Tissue Factor
- Suitable for: WB
- Reacts with: Rabbit
- Conjugation: APC. Ex: 645nm, Em: 660nm
- Isotype: IgG
Overview
-
Product name
APC Anti-Tissue Factor antibody
See all Tissue Factor primary antibodies -
Description
APC Guinea pig polyclonal to Tissue Factor -
Host species
Guinea pig -
Conjugation
APC. Ex: 645nm, Em: 660nm -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rabbit -
Immunogen
Recombinant full length protein corresponding to Rabbit Tissue Factor aa 33-292. N-terminal His-tag and S-tag. Full length mature chain expressed in E.coli.
Sequence:ADTTGRAYNLTWKSTNFKTILEWEPKSIDHVYTVQISTRLENWKSKCFLT AETECDLTDEVVKDVGQTYMARVLSYPARNGNTTGFPEEPPFRNSPEFTP YLDTNLGQPTIQSFEQVGTKLNVTVQDARTLVRRNGTFLSLRAVFGKDLN YTLYYWRASSTGKKTATTNTNEFLIDVDKGENYCFSVQAVIPSRKRKQRS PESLTECTSREQGRAREMFFIIGAVVVVALLIIVLSVTVYKCRKARAGPS GKESSPLNI
Database link: P24055 -
Positive control
- WB: Rabbit thymus, testis and lung lysates; Recombinant rabbit Tissue Factor protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at +4°C. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231522 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 33 kDa. |
Target
-
Function
Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade. -
Sequence similarities
Belongs to the tissue factor family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 100009127 Rabbit
- SwissProt: P24055 Rabbit
-
Alternative names
- CD142 antibody
- CD142 antigen antibody
- Coagulation factor III (thromboplastin tissue factor) antibody
see all
Images
-
Western blot - APC Anti-Tissue Factor antibody (ab231522)APC Anti-Tissue Factor antibody (ab231522) at 2 µg/ml + Recombinant rabbit Tissue Factor protein
Secondary
HRP-linked Rabbit anti-Guinea pig IgG at 1/5000 dilution
Predicted band size: 33 kDa -
Western blot - APC Anti-Tissue Factor antibody (ab231522)All lanes : APC Anti-Tissue Factor antibody (ab231522) at 2 µg/ml
Lane 1 : Rabbit thymus lysate
Lane 2 : Rabbit testis lysate
Lane 3 : Rabbit lung lysate
Secondary
All lanes : HRP-Linked Rabbit Anti-Guinea pig IgG Antibody at 1/5000 dilution
Predicted band size: 33 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231522 has not yet been referenced specifically in any publications.
