Anti-APC15 antibody (ab122349)
Key features and details
- Rabbit polyclonal to APC15
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-APC15 antibody -
Description
Rabbit polyclonal to APC15 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human APC15 aa 6-79.
Sequence:PSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIG KPASEHYDDEEEED
-
Positive control
- Human appendix tissue.
-
General notes
Previously labelled as C11orf51.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab122349 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. | |
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 25906 Human
- Omim: 614717 Human
- SwissProt: P60006 Human
- Unigene: 38044 Human
-
Alternative names
- ANAPC15 antibody
- Anaphase-promoting complex subunit 15 antibody
- C11orf51 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-APC15 antibody (ab122349)Immunofluorescent staining of Human cell line U-2 OS shows positivity in nucleus but not nucleoli and vesicles. Recommended concentration of ab122349 1-4 µg/ml. Cells treated with PFA/Triton X-100. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-APC15 antibody (ab122349)ab122349, at a 1/450 dilution, staining APC15 in paraffin-embedded Human appendix tissue by immunohistochemistry.
-
Western blot - Anti-APC15 antibody (ab122349)Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells. Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.
Protocols
Datasheets and documents
References (0)
ab122349 has not yet been referenced specifically in any publications.
