Anti-APC15 antibody (ab122349)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-APC15 antibody -
Description
Rabbit polyclonal to APC15 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human APC15 aa 6-79.
Sequence:PSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIG KPASEHYDDEEEED
-
Positive control
- Human appendix tissue.
-
General notes
Previously labelled as C11orf51.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab122349 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use at an assay dependent concentration. | |
ICC/IF | Use a concentration of 1 - 4 µg/ml. Recommend PFA Fixation and Triton X-100 treatment |
|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 25906 Human
- Omim: 614717 Human
- SwissProt: P60006 Human
- Unigene: 38044 Human
-
Alternative names
- ANAPC15 antibody
- Anaphase-promoting complex subunit 15 antibody
- C11orf51 antibody
see all
Images
-
Immunofluorescent staining of Human cell line U-2 OS shows positivity in nucleus but not nucleoli and vesicles. Recommended concentration of ab122349 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-APC15 antibody (ab122349)
ab122349, at a 1/450 dilution, staining APC15 in paraffin-embedded Human appendix tissue by immunohistochemistry.
-
Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells. Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.
Protocols
Datasheets and documents
References
ab122349 has not yet been referenced specifically in any publications.