Overview

  • Product name

  • Description

    Rabbit polyclonal to Apc6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide corresponding to Human Apc6 aa 181-230.
    Sequence:

    EKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQEN


    Database link: Q13042

  • Positive control

    • IHC-P: Human kidney tissue. WB: NIH-3T3 cell extract.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 0.87% Sodium chloride, 50% Glycerol

    Mg2+ and Ca2+ free
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50.
WB 1/500 - 1/1000. Predicted molecular weight: 71 kDa.

Target

  • Function

    Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the APC6/CDC16 family.
    Contains 7 TPR repeats.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylation on Ser-560 occurs specifically during mitosis.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Colocalizes with CDC27 to the centrosome at all stages of the cell cycle and to the mitotic spindle.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANAPC6 antibody
    • Anaphase promoting complex subunit 6 antibody
    • Anaphase-promoting complex subunit 6 antibody
    • Apc 6 antibody
    • APC6 antibody
    • CDC 16 antibody
    • CDC16 (cell division cycle 16 S. cerevisiae homolog) antibody
    • Cdc16 antibody
    • CDC16 homolog antibody
    • CDC16 protein antibody
    • CDC16_HUMAN antibody
    • CDC16Hs antibody
    • Cell division cycle 16 antibody
    • Cell division cycle 16 homolog antibody
    • Cell division cycle protein 16 homolog antibody
    • CUT9 antibody
    • Cyclosome subunit 6 antibody
    see all

Images

  • All lanes : Anti-Apc6 antibody (ab230926) at 1/500 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell extract
    Lane 2 : NIH/3T3 cell extract with Immunizing peptide

    Developed using the ECL technique.

    Predicted band size: 71 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Apc6 using ab230926 at 1/50 dilution in immunohistochemical analysis.

References

ab230926 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up