Overview

  • Product name

    Anti-APH antibody
  • Description

    Rabbit polyclonal to APH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human APH aa 201-500.
    Sequence:

    IKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVPENVSPGQAF WAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSL AVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPR QLGENFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTS LTAGGSGGSWKLLTIDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWV SLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQV


    Database link: P13798

  • Positive control

    • WB: HeLa whole cell lysate; Mouse liver tissue lysate. IHC-P: Human renal and colon cancer tissue. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as AARE

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/5000.

Target

Images

  • All lanes : Anti-APH antibody (ab236608) at 1/2000 dilution

    Lane 1 : HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling ab236608 using ab236608 at 1/100 dilution in ICC/IF. Secondary antibody was an Alexa-Fluor®488-conjugated goat anti-rabbit IgG (H+L).

  • Paraffin-embedded human renal tissue stained for APH using ab236608 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for APH using ab236608 at 1/100 dilution in immunohistochemical analysis.

References

ab236608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up