Overview

  • Product name

  • Description

    Rabbit polyclonal to Apo-H
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human Apo-H aa 119-345.
    Sequence:

    ADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRD TAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNY PAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPV KKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDG TIEVPKCFKEHSSLAFWKTDASDVKPC


    Database link: P02749

  • Positive control

    • IHC-P: Human liver cancer tissue. ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as Apolipoprotein H. 

Properties

Applications

Our Abpromise guarantee covers the use of ab236960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Sequence similarities

    Contains 4 Sushi (CCP/SCR) domains.
  • Post-translational
    modifications

    N- and O-glycosylated. PubMed:6587378 also reports glycosylation on 'Asn-188' for their allele.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activated protein C binding protein antibody
    • Activated protein C-binding protein antibody
    • Anticardiolipin cofactor antibody
    • APC inhibitor antibody
    • Apo-H antibody
    • APOH antibody
    • APOH_HUMAN antibody
    • apolipoprotein H (beta-2-glycoprotein I) antibody
    • Apolipoprotein H antibody
    • B2G1 antibody
    • B2GP1 antibody
    • B2GPI antibody
    • Beta 2 glycoprotein I antibody
    • Beta 2 glycoprotein I precursor antibody
    • Beta(2)GPI antibody
    • Beta-2-glycoprotein 1 antibody
    • Beta-2-glycoprotein I antibody
    • BG antibody
    • Glycoprotein 1, beta-2 antibody
    • Glycoprotein I, beta-2 antibody
    • OTTMUSP00000003033 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for Apo-H using ab236960 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for Apo-H (green) using ab236960 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up