Overview

  • Product name

  • Description

    Rabbit polyclonal to Apo-M
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Dog
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Dog Apo-M aa 23-188. Full length mature chain expressed in E. coli.
    Sequence:

    CPEYSQLTTQGVDGKEFPEPHLGRWYFIAGAAPTKEELVTFDPVDNIVFS MATGSAPMQLQLRATIRMKNGHCVPRKWIYHLTEGSTDLRTEGRPDMRTM LFSSSCPGGIMLKESGHGYQRFLLYNRSPHPHETCVEEFQSLTSCLDFKA FLRTPRNQEACELSSN


    Database link: E2RQ71

  • Positive control

    • WB: Dog and rat serum.

Properties

Applications

Our Abpromise guarantee covers the use of ab231016 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 21 kDa.

Target

  • Function

    Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid.
  • Tissue specificity

    Plasma protein. Expressed in liver and kidney.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family. Highly divergent.
  • Cellular localization

    Secreted. Present in high density lipoprotein (HDL) and to a lesser extent in triglyceride-rich lipoproteins (TGRLP) and low density lipoproteins.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apo M antibody
    • Apo-M antibody
    • Apolipoprotein M antibody
    • ApoM antibody
    • APOM_HUMAN antibody
    • G3A antibody
    • HSPC336 antibody
    • MGC22400 antibody
    • NG20 antibody
    • NG20 like protein antibody
    • Protein G3a antibody
    see all

Images

  • Anti-Apo-M antibody (ab231016) at 2 µg/ml + Rat serum

    Predicted band size: 21 kDa

  • Anti-Apo-M antibody (ab231016) at 2 µg/ml + Dog serum

    Predicted band size: 21 kDa

  • Anti-Apo-M antibody (ab231016) at 2 µg/ml + Recombinant dog Apo-M protein

    Predicted band size: 21 kDa

References

ab231016 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231016.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up