Overview

  • Product name

    Anti-APOA4/Apo-AIV antibody [C8]
    See all APOA4/Apo-AIV primary antibodies
  • Description

    Mouse monoclonal [C8] to APOA4/Apo-AIV
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Pig APOA4/Apo-AIV aa 21-382. Expressed in E coli with N-terminal His and GST tags.
    Sequence:

    EVNADQVATVMWDYFSQLGSNAKKAVEHLQKSELTQQLNTLFQDKLGEVN TYTEDLQKKLVPFATELHERLTKDSEKLKEEIRRELEELRARLLPHATEV SQKIGDNVRELQQRLGPFTGGLRTQVNTQVQQLQRQLKPYAERMESVLRQ NIRNLEASVAPYADEFKAKIDQNVEELKGSLTPYAEELKAKIDQNVEELR RSLAPYAQDVQEKLNHQLEGLAFQMKKQAEELKAKISANADELRQKLVPV AENVHGHLKGNTEGLQKSLLELRSHLDQQVEEFRLKVEPYGETFNKALVQ QVEDLRQKLGPLAGDVEGHLSFLEKDLRDKVNTFFSTLKEEASQGQSQAL PAQEKAQAPLEG


    Database link: O46409

  • Positive control

    • WB: Human serum; Recombinant pig APOA4/Apo-AIV protein.
  • General notes

     This product was previously labelled as APOA4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab239480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 3 µg/ml. Predicted molecular weight: 43 kDa.

Target

  • Relevance

    APOA4 (apolipoprotein A-IV) is a component of HDL and chylomicrons. Its primary site of synthesis is the intestine, in association with lymph chylomicron particles. Although its precise function is not known, APOA4 is a potent activator of lecithin-cholesterol acyltransferase (LCAT) in vitro. In rodents, Apo A-IV inhibits gastric emptying and serves as a satiety factor whose synthesis and secretion are increased by the ingestion of dietary fat. It also possesses anti-inflammatory and antiatherogenic properties
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Apo AIV antibody
    • APOA 4 antibody
    • ApoA IV antibody
    • APOA4 antibody
    • Apolipoprotein A IV antibody
    • Apolipoprotein A4 antibody
    • MGC142154 antibody
    • MGC142156 antibody
    see all

Images

  • Anti-APOA4/Apo-AIV antibody [C8] (ab239480) at 3 µg/ml + Human serum

    Predicted band size: 43 kDa

  • Anti-APOA4/Apo-AIV antibody [C8] (ab239480) at 2 µg/ml + Recombinant pig APOA4/Apo-AIV protein

    Predicted band size: 43 kDa

References

ab239480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up