For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    apobec3ga3g-antibody-ab172694.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Interspecies Interaction Host Virus Interaction
Share by email

Anti-APOBEC3G/A3G antibody (ab172694)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-APOBEC3G/A3G antibody (ab172694)

    Key features and details

    • Mouse polyclonal to APOBEC3G/A3G
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Protein
    Product image
    Recombinant Human APOBEC3G/A3G protein (ab132965)
    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-APOBEC3G/A3G antibody
      See all APOBEC3G/A3G primary antibodies
    • Description

      Mouse polyclonal to APOBEC3G/A3G
    • Host species

      Mouse
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Chimpanzee, Gorilla, Orangutan
    • Immunogen

      Full length protein corresponding to Human APOBEC3G/A3G aa 1-384. (AAH24268.1)
      Sequence:

      MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLD AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC TRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMK IMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPP TFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKH GFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFIS KNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN


      Database link: Q9HC16
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • APOBEC3G/A3G -transfected 293T cell lysate.
    • General notes

      Previously labelled as APOBEC3G

      The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

      If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.4
      Constituent: 100% PBS
    • Concentration information loading...
    • Purity

      Protein A purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Microbiology
      • Interspecies Interaction
      • Host Virus Interaction
      • Epigenetics and Nuclear Signaling
      • Chromatin Binding Proteins
      • DNA / RNA binding
      • Epigenetics and Nuclear Signaling
      • Chromatin Modifying Enzymes
      • Deamination
      • Immunology
      • Immune System Diseases
      • Antiviral Signaling
      • Immunology
      • Immune System Diseases
      • Antiviral Signaling
      • HIV-related

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG - Isotype Control (ab37355)
    • Recombinant Protein

      • Recombinant Human APOBEC3G/A3G protein (ab132965)
    • Related Products

      • Recombinant Human APOBEC3G/A3G protein (ab132965)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab172694 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB
    Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa.
    Notes
    WB
    Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa.

    Target

    • Function

      DNA deaminase (cytidine deaminase) that mediates a form of innate resistance to retroviral infections (at least to HIV-1 infection) by triggering G-to-A hypermutation in the newly synthesized viral DNA. The replacements C-to-U in the minus strand DNA of HIV-1 during reverse transcription, leads to G-to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations. Modification of both DNA strands is not excluded. This antiviral activity is neutralized by the virion infectivity factor (VIF), that prevents the incorporation of APOBEC3G into progeny HIV-1 virions by both inhibiting its translation and/or by inducing its ubiquitination and subsequent degradation by the 26S proteasome. APOBEC3G binds a variety of RNAs, but does not display detectable APOB, NF1 and NAT1 mRNA editing.
    • Tissue specificity

      Expressed in spleen, testes, ovary and peripheral blood leukocytes and CD4+ lymphocytes. Also expressed in non-permissive peripheral blood mononuclear cells, and several tumor cell lines; no expression detected in permissive lymphoid and non-lymphoid cell lines.
    • Sequence similarities

      Belongs to the cytidine and deoxycytidylate deaminase family.
    • Post-translational
      modifications

      Ubiquitinated in the presence of HIV-1 VIF. Association with VIF targets the protein for proteolysis by the ubiquitin-dependent proteasome pathway.
    • Cellular localization

      Cytoplasm. Nucleus. Mainly cytoplasmic. Small amount are found in the nucleus. During HIV-1 infection, virion-encapsidated in absence of HIV-1 VIF.
    • Target information above from: UniProt accession Q9HC16 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 449577 Chimpanzee
      • Entrez Gene: 101137376 Gorilla
      • Entrez Gene: 200316 Human
      • Entrez Gene: 60489 Human
      • Entrez Gene: 100458402 Orangutan
      • Omim: 607113 Human
      • SwissProt: Q694B6 Chimpanzee
      • SwissProt: Q7YR24 Chimpanzee
      • SwissProt: Q694C1 Gorilla
      • SwissProt: Q9HC16 Human
      • SwissProt: Q694C0 Orangutan
      • Unigene: 659809 Human
      • Unigene: 660143 Human
      see all
    • Alternative names

      • A3G antibody
      • ABC3G_HUMAN antibody
      • APOBEC related cytidine deaminase antibody
      • APOBEC related protein antibody
      • APOBEC-related cytidine deaminase antibody
      • APOBEC-related protein 9 antibody
      • APOBEC-related protein antibody
      • APOBEC3G antibody
      • Apolipoprotein B editing enzyme catalytic polypeptide like 3G antibody
      • Apolipoprotein B mRNA editing enzyme catalytic polypeptide 3G antibody
      • Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3G antibody
      • Apolipoprotein B mRNA editing enzyme catalytic subunit 3G antibody
      • apolipoprotein B mRNA editing enzyme cytidine deaminase antibody
      • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like antibody
      • ARCD antibody
      • ARP-9 antibody
      • ARP9 antibody
      • bK150C2.7 antibody
      • CEM-15 antibody
      • CEM15 antibody
      • deoxycytidine deaminase antibody
      • dJ494G10.1 antibody
      • DNA dC dU editing enzyme APOBEC 3G antibody
      • DNA dC->dU editing enzyme antibody
      • DNA dC->dU-editing enzyme APOBEC-3G antibody
      • EC 3.5.4. antibody
      • FLJ12740 antibody
      • MDS019 antibody
      • OTTHUMP00000028911 antibody
      • phorbolin-like protein antibody
      • phorbolin-like protein MDS019 antibody
      see all

    Images

    • Western blot - Anti-APOBEC3G/A3G antibody (ab172694)
      Western blot - Anti-APOBEC3G/A3G antibody (ab172694)
      All lanes : Anti-APOBEC3G/A3G antibody (ab172694) at 1 µg/ml

      Lane 1 : APOBEC3G -transfected 293T cell lysate
      Lane 2 : Non-transfected 293T cell lysate

      Lysates/proteins at 15 µl per lane.

      Developed using the ECL technique.

      Predicted band size: 46 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab172694? Please let us know so that we can cite the reference in this datasheet.

    ab172694 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab172694.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.