Anti-APOBEC3G/A3G antibody (ab172694)
Key features and details
- Mouse polyclonal to APOBEC3G/A3G
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-APOBEC3G/A3G antibody
See all APOBEC3G/A3G primary antibodies -
Description
Mouse polyclonal to APOBEC3G/A3G -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Gorilla, Orangutan -
Immunogen
Full length protein corresponding to Human APOBEC3G/A3G aa 1-384. (AAH24268.1)
Sequence:MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLD AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC TRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMK IMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPP TFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKH GFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFIS KNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN
Database link: Q9HC16 -
Positive control
- APOBEC3G/A3G -transfected 293T cell lysate.
-
General notes
Previously labelled as APOBEC3G
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab172694 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa. |
Target
-
Function
DNA deaminase (cytidine deaminase) that mediates a form of innate resistance to retroviral infections (at least to HIV-1 infection) by triggering G-to-A hypermutation in the newly synthesized viral DNA. The replacements C-to-U in the minus strand DNA of HIV-1 during reverse transcription, leads to G-to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations. Modification of both DNA strands is not excluded. This antiviral activity is neutralized by the virion infectivity factor (VIF), that prevents the incorporation of APOBEC3G into progeny HIV-1 virions by both inhibiting its translation and/or by inducing its ubiquitination and subsequent degradation by the 26S proteasome. APOBEC3G binds a variety of RNAs, but does not display detectable APOB, NF1 and NAT1 mRNA editing. -
Tissue specificity
Expressed in spleen, testes, ovary and peripheral blood leukocytes and CD4+ lymphocytes. Also expressed in non-permissive peripheral blood mononuclear cells, and several tumor cell lines; no expression detected in permissive lymphoid and non-lymphoid cell lines. -
Sequence similarities
Belongs to the cytidine and deoxycytidylate deaminase family. -
Post-translational
modificationsUbiquitinated in the presence of HIV-1 VIF. Association with VIF targets the protein for proteolysis by the ubiquitin-dependent proteasome pathway. -
Cellular localization
Cytoplasm. Nucleus. Mainly cytoplasmic. Small amount are found in the nucleus. During HIV-1 infection, virion-encapsidated in absence of HIV-1 VIF. - Information by UniProt
-
Database links
- Entrez Gene: 449577 Chimpanzee
- Entrez Gene: 101137376 Gorilla
- Entrez Gene: 200316 Human
- Entrez Gene: 60489 Human
- Entrez Gene: 100458402 Orangutan
- Omim: 607113 Human
- SwissProt: Q694B6 Chimpanzee
- SwissProt: Q7YR24 Chimpanzee
see all -
Alternative names
- A3G antibody
- ABC3G_HUMAN antibody
- APOBEC related cytidine deaminase antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab172694 has not yet been referenced specifically in any publications.