Overview

  • Product name

    Anti-APOBEC3G/A3G antibody
    See all APOBEC3G/A3G primary antibodies
  • Description

    Rabbit polyclonal to APOBEC3G/A3G
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human APOBEC3G/A3G aa 60-330.
    Sequence:

    SELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLA EDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQH CWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNNE PWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAE LCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCI FTARIYDDQGRCQEGLRTLAE


    Database link: Q9HC16

  • Positive control

    • Extracts of Jurkat cell line; Human rectal cancer tissue; rat testis tissue; MCF7 cell.
  • General notes

    Previously labelled as APOBEC3G

Properties

Applications

Our Abpromise guarantee covers the use of ab194581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 46 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    DNA deaminase (cytidine deaminase) that mediates a form of innate resistance to retroviral infections (at least to HIV-1 infection) by triggering G-to-A hypermutation in the newly synthesized viral DNA. The replacements C-to-U in the minus strand DNA of HIV-1 during reverse transcription, leads to G-to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations. Modification of both DNA strands is not excluded. This antiviral activity is neutralized by the virion infectivity factor (VIF), that prevents the incorporation of APOBEC3G into progeny HIV-1 virions by both inhibiting its translation and/or by inducing its ubiquitination and subsequent degradation by the 26S proteasome. APOBEC3G binds a variety of RNAs, but does not display detectable APOB, NF1 and NAT1 mRNA editing.
  • Tissue specificity

    Expressed in spleen, testes, ovary and peripheral blood leukocytes and CD4+ lymphocytes. Also expressed in non-permissive peripheral blood mononuclear cells, and several tumor cell lines; no expression detected in permissive lymphoid and non-lymphoid cell lines.
  • Sequence similarities

    Belongs to the cytidine and deoxycytidylate deaminase family.
  • Post-translational
    modifications

    Ubiquitinated in the presence of HIV-1 VIF. Association with VIF targets the protein for proteolysis by the ubiquitin-dependent proteasome pathway.
  • Cellular localization

    Cytoplasm. Nucleus. Mainly cytoplasmic. Small amount are found in the nucleus. During HIV-1 infection, virion-encapsidated in absence of HIV-1 VIF.
  • Information by UniProt
  • Database links

  • Alternative names

    • A3G antibody
    • ABC3G_HUMAN antibody
    • APOBEC related cytidine deaminase antibody
    • APOBEC related protein antibody
    • APOBEC-related cytidine deaminase antibody
    • APOBEC-related protein 9 antibody
    • APOBEC-related protein antibody
    • APOBEC3G antibody
    • Apolipoprotein B editing enzyme catalytic polypeptide like 3G antibody
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide 3G antibody
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3G antibody
    • Apolipoprotein B mRNA editing enzyme catalytic subunit 3G antibody
    • apolipoprotein B mRNA editing enzyme cytidine deaminase antibody
    • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like antibody
    • ARCD antibody
    • ARP-9 antibody
    • ARP9 antibody
    • bK150C2.7 antibody
    • CEM-15 antibody
    • CEM15 antibody
    • deoxycytidine deaminase antibody
    • dJ494G10.1 antibody
    • DNA dC dU editing enzyme APOBEC 3G antibody
    • DNA dC->dU editing enzyme antibody
    • DNA dC->dU-editing enzyme APOBEC-3G antibody
    • EC 3.5.4. antibody
    • FLJ12740 antibody
    • MDS019 antibody
    • OTTHUMP00000028911 antibody
    • phorbolin-like protein antibody
    • phorbolin-like protein MDS019 antibody
    see all

Images

  • Anti-APOBEC3G/A3G antibody (ab194581) at 1/500 dilution + Extracts of Jurkat cell line

    Predicted band size: 46 kDa

  • Immunohistochemistry analysis of paraffin-embedded Human rectal cancer tissue labeling APOBEC3G/A3G with ab194581 at 1:100 dilution (200x lens).

  • Immunohistochemistry analysis of paraffin embedded Rat testis tissue labeling APOBEC3G/A3G with ab194581 at 1/100 dilution (200x lens).  

  • Immunofluorescent analysis of MCF7 cell labeling APOBEC3G/A3G using ab194581 at a 1/50 dilution.

    Blue: DAPI for nuclear staining.

References

ab194581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up