Overview

  • Product name

  • Description

    Rabbit polyclonal to APOF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human APOF aa 122-307. (Expressed in E.coli)
    Sequence:

    VLIQHLRGLQKGRSTERNVSVEALASALQLLAREQQSTGRVGRSLPTEDC ENEKEQAVHNVVQLLPGVGTFYNLGTALYYATQNCLGKARERGRDGAIDL GYDLLMTMAGMSGGPMGLAISAALKPALRSGVQQLIQYYQDQKDANISQP ETTKEGLRAISDVSDLEETTTLASFISEVVSSAPYW


    Database link: Q13790

  • Positive control

    • IHC-P: Human liver and esophagus tissues. WB: Recombinant human APOF protein; Mouse cerebrum and liver lysates; Human liver and lung lysates.
  • General notes

     This product was previously labelled as Apolipoprotein F

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 35 kDa.

Target

  • Function

    Minor apolipoprotein that associates with LDL. Inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Also associates to a lesser degree with VLDL, Apo-AI and Apo-AII.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apo-F antibody
    • Apof antibody
    • APOF_HUMAN antibody
    • Apolipoprotein F antibody
    • DKFZp781G18150 antibody
    • Lipid transfer inhibitor protein antibody
    • LTIP antibody
    • MGC22520 antibody
    see all

Images

  • Anti-APOF antibody (ab231585) at 2 µg/ml + Mouse liver lysate.

    Predicted band size: 35 kDa

  • Anti-APOF antibody (ab231585) at 2 µg/ml + Human lung lysate.

    Predicted band size: 35 kDa

  • Anti-APOF antibody (ab231585) at 2 µg/ml + Human liver lysate.

    Predicted band size: 35 kDa

  • Anti-APOF antibody (ab231585) at 2 µg/ml + Mouse cerebrum lysate.

    Predicted band size: 35 kDa

  • Anti-APOF antibody (ab231585) at 2 µg/ml + Recombinant human APOF protein

    Predicted band size: 35 kDa

  • Paraffin-embedded human esophagus tissue stained for APOF using ab231585 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for APOF using ab231585 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab231585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up