Anti-Apolipoprotein A II/ApoA-II antibody (ab231550)
Key features and details
- Rabbit polyclonal to Apolipoprotein A II/ApoA-II
- Suitable for: WB, IHC-P
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-Apolipoprotein A II/ApoA-II antibody
See all Apolipoprotein A II/ApoA-II primary antibodies -
Description
Rabbit polyclonal to Apolipoprotein A II/ApoA-II -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat -
Immunogen
Recombinant full length protein corresponding to Rat Apolipoprotein A II/ApoA-II aa 24-102. (N-terminal His-tag and GST-tag; Expressed in E.coli).
Sequence:QAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLT PFVQRTGTNLMDFLSRLMSPEEKPAPAAK
Database link: P04638 -
Positive control
- IHC-P: Rat testis, kidney, liver and stomach tissues. WB: Rat serum; Rat liver and blood cell lysates; Recombinant rat Apolipoprotein A II/ApoA-II protein.
-
General notes
This product was previously labelled as Apolipoprotein A II
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231550 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
- Metabolism
- Pathways and Processes
- Metabolic signaling pathways
- Lipid and lipoprotein metabolism
- Lipid metabolism
- Metabolism
- Pathways and Processes
- Metabolic signaling pathways
- Lipid and lipoprotein metabolism
- Cholesterol Metabolism
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231550 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 11 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. -
Tissue specificity
Plasma; synthesized in the liver and intestine. -
Sequence similarities
Belongs to the apolipoprotein A2 family. -
Post-translational
modificationsPhosphorylation sites are present in the extracelllular medium. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 25649 Rat
- SwissProt: P04638 Rat
- Unigene: 89304 Rat
-
Alternative names
- APO A2 antibody
- Apo AII antibody
- Apo-AII antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Apolipoprotein A II/ApoA-II antibody (ab231550)
Formalin-fixed, paraffin-embedded rat testis tissue stained for Apolipoprotein A II/ApoA-II using ab231550 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Apolipoprotein A II/ApoA-II antibody (ab231550)
Formalin-fixed, paraffin-embedded rat kidney tissue stained for Apolipoprotein A II/ApoA-II using ab231550 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Apolipoprotein A II/ApoA-II antibody (ab231550)
Formalin-fixed, paraffin-embedded rat liver tissue stained for Apolipoprotein A II/ApoA-II using ab231550 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Apolipoprotein A II/ApoA-II antibody (ab231550)
Formalin-fixed, paraffin-embedded rat stomach tissue stained for Apolipoprotein A II/ApoA-II using ab231550 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Apolipoprotein A II/ApoA-II antibody (ab231550) at 2 µg/ml + Recombinant rat Apolipoprotein A II/ApoA-II protein
Predicted band size: 11 kDa -
Anti-Apolipoprotein A II/ApoA-II antibody (ab231550) at 2 µg/ml + Rat serum
Predicted band size: 11 kDa -
Anti-Apolipoprotein A II/ApoA-II antibody (ab231550) at 2 µg/ml + Rat liver lysate
Predicted band size: 11 kDa -
Anti-Apolipoprotein A II/ApoA-II antibody (ab231550) at 2 µg/ml + Rat blood cell lysate
Predicted band size: 11 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231550 has not yet been referenced specifically in any publications.