Overview

  • Product name

    Anti-Apolipoprotein B antibody
    See all Apolipoprotein B primary antibodies
  • Description

    Rabbit polyclonal to Apolipoprotein B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Apolipoprotein B aa 3365-3548. (Expressed in E.coli).
    Sequence:

    HLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTV SLTTKNMEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDF NSSMLYSTAKGAVDHKLSLESLTSYFSIESSTKGDVKGSVLSREYSGTIA SEANTYLNSKSTRSSVKLQGTSKIDDIWNLEVKE


    Database link: P04114

  • Positive control

    • WB: Recombinant human Apolipoprotein B protein; Pig liver lysate. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231574 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 516 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
  • Involvement in disease

    Hypobetalipoproteinemia, familial, 1
    Familial ligand-defective apolipoprotein B-100
    Defects in APOB associated with defects in other genes (polygenic) can contribute to hypocholesterolemia.
  • Sequence similarities

    Contains 1 vitellogenin domain.
  • Post-translational
    modifications

    Palmitoylated; structural requirement for proper assembly of the hydrophobic core of the lipoprotein particle.
  • Cellular localization

    Cytoplasm. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apo B 100 antibody
    • Apo B antibody
    • Apo B-100 antibody
    • Apo B-48 antibody
    • Apo B100 antibody
    • Apo B48 antibody
    • ApoB 100 antibody
    • ApoB 48 antibody
    • APOB antibody
    • APOB_HUMAN antibody
    • Apolipoprotein B (including Ag(x) antigen) antibody
    • Apolipoprotein B 100 antibody
    • Apolipoprotein B 48 antibody
    • Apolipoprotein B antibody
    • Apolipoprotein B-48 antibody
    • Apolipoprotein B100 antibody
    • Apolipoprotein B48 antibody
    • FLDB antibody
    • LDLCQ4 antibody
    see all

Images

  • Anti-Apolipoprotein B antibody (ab231574) at 2 µg/ml + Recombinant human Apolipoprotein B protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 516 kDa

  • Anti-Apolipoprotein B antibody (ab231574) at 2 µg/ml + Pig liver lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 516 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Apolipoprotein B using ab231574 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231574 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231574.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up