Overview

  • Product name
    Anti-Apolipoprotein CI antibody
    See all Apolipoprotein CI primary antibodies
  • Description
    Rabbit polyclonal to Apolipoprotein CI
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Apolipoprotein CI aa 31-83. (Expressed in E.coli).
    Sequence:

    SSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLK IDS


    Database link: P02654

  • Positive control
    • WB: Recombinant human Apolipoprotein CI protein; Human serum; Human placenta lysate; Mouse liver and heart lysates. IHC-P: Human liver and liver cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 9 kDa.

Target

  • Function
    Appears to modulate the interaction of APOE with beta-migrating VLDL and inhibit binding of beta-VLDL to the LDL receptor-related protein. Binds free fatty acids and reduces their intracellular esterification.
  • Tissue specificity
    Synthesized mainly in liver and to a minor degree in intestine. Secreted in plasma.
  • Sequence similarities
    Belongs to the apolipoprotein C1 family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • APO C1 antibody
    • Apo CI antibody
    • Apo-CIB antibody
    • Apo-CIB' antibody
    • APOC 1 antibody
    • ApoC I antibody
    • ApoC-IB antibody
    • ApoC-IB' antibody
    • APOC1 antibody
    • APOC1_HUMAN antibody
    • APOC1B antibody
    • Apolipoprotein C I antibody
    • Apolipoprotein C I variant I antibody
    • Apolipoprotein C-I antibody
    • Apolipoprotein C1 antibody
    • Apolipoprotein CI antibody
    • ApolipoproteinC I antibody
    • ApolipoproteinCI antibody
    • Truncated apolipoprotein C-I antibody
    see all

Images

  • Anti-Apolipoprotein CI antibody (ab231570) at 2 µg/ml + Recombinant human Apolipoprotein CI protein

    Predicted band size: 9 kDa

  • All lanes : Anti-Apolipoprotein CI antibody (ab231570) at 2 µg/ml

    Lane 1 : Human serum
    Lane 2 : Human placenta lysate


    Predicted band size: 9 kDa

  • Paraffin-embedded human liver tissue stained for Apolipoprotein CI using ab231570 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for Apolipoprotein CI using ab231570 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

This product has been referenced in:
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up