Overview

  • Product name

    Anti-Apolipoprotein CI/Apo-CI antibody
    See all Apolipoprotein CI/Apo-CI primary antibodies
  • Description

    Rabbit polyclonal to Apolipoprotein CI/Apo-CI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human Apolipoprotein CI/Apo-CI aa 1-83.
    Sequence:

    MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARE LISRIKQSELSAKMREWFSETFQKVKEKLKIDS


    Database link: P02654

  • Positive control

    • Apolipoprotein CI/Apo-CI recombinant protein
  • General notes

     This product was previously labelled as Apolipoprotein CI

     

Properties

Applications

Our Abpromise guarantee covers the use of ab189866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 9 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function

    Appears to modulate the interaction of APOE with beta-migrating VLDL and inhibit binding of beta-VLDL to the LDL receptor-related protein. Binds free fatty acids and reduces their intracellular esterification.
  • Tissue specificity

    Synthesized mainly in liver and to a minor degree in intestine. Secreted in plasma.
  • Sequence similarities

    Belongs to the apolipoprotein C1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • APO C1 antibody
    • Apo CI antibody
    • Apo-CIB antibody
    • Apo-CIB' antibody
    • APOC 1 antibody
    • ApoC I antibody
    • ApoC-IB antibody
    • ApoC-IB' antibody
    • APOC1 antibody
    • APOC1_HUMAN antibody
    • APOC1B antibody
    • Apolipoprotein C I antibody
    • Apolipoprotein C I variant I antibody
    • Apolipoprotein C-I antibody
    • Apolipoprotein C1 antibody
    • Apolipoprotein CI antibody
    • ApolipoproteinC I antibody
    • ApolipoproteinCI antibody
    • Truncated apolipoprotein C-I antibody
    see all

Images

  • Immunohistochemistry of paraffin-embedded human colon using ab189866 at dilution of 1:100

  • Immunohistochemistry of paraffin-embedded rat liver using ab189866 at dilution of 1:100

  • Anti-Apolipoprotein CI/Apo-CI antibody (ab189866) at 1/500 dilution + Apolipoprotein CI/Apo-CI recombinant protein

    Predicted band size: 9 kDa

References

ab189866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up