Overview

  • Product name

    Anti-Apolipoprotein CI/Apo-CI antibody
    See all Apolipoprotein CI/Apo-CI primary antibodies
  • Description

    Rabbit polyclonal to Apolipoprotein CI/Apo-CI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Apolipoprotein CI/Apo-CI aa 31-83. (Expressed in E.coli).
    Sequence:

    SSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLK IDS


    Database link: P02654

  • Positive control

    • WB: Recombinant human Apolipoprotein CI/Apo-CI protein; Human serum; Human placenta lysate; Mouse liver and heart lysates. IHC-P: Human liver and liver cancer tissues.
  • General notes

     This product was previously labelled as Apolipoprotein CI

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 9 kDa.

Target

  • Function

    Appears to modulate the interaction of APOE with beta-migrating VLDL and inhibit binding of beta-VLDL to the LDL receptor-related protein. Binds free fatty acids and reduces their intracellular esterification.
  • Tissue specificity

    Synthesized mainly in liver and to a minor degree in intestine. Secreted in plasma.
  • Sequence similarities

    Belongs to the apolipoprotein C1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • APO C1 antibody
    • Apo CI antibody
    • Apo-CIB antibody
    • Apo-CIB' antibody
    • APOC 1 antibody
    • ApoC I antibody
    • ApoC-IB antibody
    • ApoC-IB' antibody
    • APOC1 antibody
    • APOC1_HUMAN antibody
    • APOC1B antibody
    • Apolipoprotein C I antibody
    • Apolipoprotein C I variant I antibody
    • Apolipoprotein C-I antibody
    • Apolipoprotein C1 antibody
    • Apolipoprotein CI antibody
    • ApolipoproteinC I antibody
    • ApolipoproteinCI antibody
    • Truncated apolipoprotein C-I antibody
    see all

Images

  • Anti-Apolipoprotein CI/Apo-CI antibody (ab231570) at 2 µg/ml + Recombinant human Apolipoprotein CI/Apo-CI protein

    Predicted band size: 9 kDa

  • All lanes : Anti-Apolipoprotein CI/Apo-CI antibody (ab231570) at 2 µg/ml

    Lane 1 : Human serum
    Lane 2 : Human placenta lysate
    Lane 3 : Mouse liver lysate
    Lane 4 : Mouse heart lysate

    Predicted band size: 9 kDa

  • Paraffin-embedded human liver tissue stained for Apolipoprotein CI/Apo-CI using ab231570 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for Apolipoprotein CI/Apo-CI using ab231570 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up