Overview

  • Product name

    Anti-Apolipoprotein CIV antibody
    See all Apolipoprotein CIV primary antibodies
  • Description

    Rabbit polyclonal to Apolipoprotein CIV
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Mouse Apolipoprotein CIV aa 28-124. N-terminal His-tag and GST-tags; Expressed in E.coli.
    Sequence:

    MSTESLSPTPGPESSRWSLVRARVLEMVEPLVTRTRDRWQWFWGPGAVQG FMQTYYEDHLKDLGPRTQAWQSSRDHLLNKTHSLCPRLLCKDRTQG


    Database link: Q61268

  • Positive control

    • WB: Mouse serum; Recombinant mouse Apolipoprotein CIV protein. IHC-P: Mouse kidney and liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 14 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for Apolipoprotein CIV using ab232710 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for Apolipoprotein CIV using ab232710 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Apolipoprotein CIV antibody (ab232710) at 1 µg/ml + Mouse serum

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 14 kDa

  • Anti-Apolipoprotein CIV antibody (ab232710) at 1 µg/ml + Recombinant mouse Apolipoprotein CIV protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 14 kDa

References

ab232710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up