Overview

  • Product name

    Anti-Apolipoprotein L1/APOL1 antibody
    See all Apolipoprotein L1/APOL1 primary antibodies
  • Description

    Rabbit polyclonal to Apolipoprotein L1/APOL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Apolipoprotein L1/APOL1 aa 1-238. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSK PLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAA AELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSE LEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFT EGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA


    Database link: O14791

  • Positive control

    • IHC-P: Human kidney tissue. WB: MCF7 cell lysate; Recombinant human Apolipoprotein L 1/APOL1 protein.
  • General notes

     This product was previously labelled as Apolipoprotein L 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 44 kDa.

Target

  • Function

    May play a role in lipid exchange and transport throughout the body. May participate in reverse cholesterol transport from peripheral cells to the liver.
  • Tissue specificity

    Plasma. Found on APOA-I-containing high density lipoprotein (HDL3). Expressed in pancreas, lung, prostate, liver, placenta and spleen.
  • Involvement in disease

    Defects in APOL1 are the cause of focal segmental glomerulosclerosis type 4 (FSGS4) [MIM:612551]. It is a renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation.
  • Sequence similarities

    Belongs to the apolipoprotein L family.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • APO L antibody
    • Apo-L antibody
    • ApoL antibody
    • APOL I antibody
    • ApoL-I antibody
    • APOL1 antibody
    • APOL1_HUMAN antibody
    • APOLI antibody
    • Apolipoprotein L antibody
    • Apolipoprotein L I antibody
    • Apolipoprotein L-I antibody
    • Apolipoprotein L1 antibody
    • FSGS4 antibody
    see all

Images

  • Anti-Apolipoprotein L1/APOL1 antibody (ab231523) at 3 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 44 kDa

  • Paraffin-embedded human kidney tissue stained for Apolipoprotein L 1/APOL1 using ab231523 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Apolipoprotein L1/APOL1 antibody (ab231523) at 5 µg/ml + Recombinant human Apolipoprotein L 1/APOL1 protein

    Predicted band size: 44 kDa

References

ab231523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up