Overview

  • Product name

    Anti-Apolipoprotein L1/APOL1 antibody [CL0171]
    See all Apolipoprotein L1/APOL1 primary antibodies
  • Description

    Mouse monoclonal [CL0171] to Apolipoprotein L1/APOL1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Apolipoprotein L1/APOL1 aa 263-387.
    Sequence:

    SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISA ESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEG AKSETAEELKKVAQELEEKLNILNN


    Database link: O14791

  • Epitope

    This antibody binds to an epitope located within the peptide sequence AEELKKVAQELEEKL (aa 368-382).
  • Positive control

    • Human colon and lung tissues; human plasma lysate.
  • General notes

     This product was previously labelled as Apolipoprotein L 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab211462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000.
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in lipid exchange and transport throughout the body. May participate in reverse cholesterol transport from peripheral cells to the liver.
  • Tissue specificity

    Plasma. Found on APOA-I-containing high density lipoprotein (HDL3). Expressed in pancreas, lung, prostate, liver, placenta and spleen.
  • Involvement in disease

    Defects in APOL1 are the cause of focal segmental glomerulosclerosis type 4 (FSGS4) [MIM:612551]. It is a renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation.
  • Sequence similarities

    Belongs to the apolipoprotein L family.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • APO L antibody
    • Apo-L antibody
    • ApoL antibody
    • APOL I antibody
    • ApoL-I antibody
    • APOL1 antibody
    • APOL1_HUMAN antibody
    • APOLI antibody
    • Apolipoprotein L antibody
    • Apolipoprotein L I antibody
    • Apolipoprotein L-I antibody
    • Apolipoprotein L1 antibody
    • FSGS4 antibody
    see all

Images

  • Immunohistochemical analysis of human colon tissue labeling Apolipoprotein L 1/APOL1 with ab211462 at 1/2500 dilution.

  • Immunohistochemical analysis of human lung tissue labeling Apolipoprotein L 1/APOL1 with ab211462 at 1/2500 dilution.

  • Anti-Apolipoprotein L1/APOL1 antibody [CL0171] (ab211462) at 1/500 dilution + human plasma lysate

References

ab211462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (human RCC 786-0)
Gel Running Conditions
Reduced Denaturing (4-12% nupage bis-Tris gel)
Loading amount
10 µg
Specification
human RCC 786-0
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 24°C

Abcam user community

Verified customer

Submitted Sep 08 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up