Overview

  • Product name

    Anti-Apolipoprotein O antibody
  • Description

    Rabbit polyclonal to Apolipoprotein O
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human Apolipoprotein O aa 133-198.
    Sequence:

    IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWK ENFQKPGNVKNSPGTK


    Database link: Q9BUR5

  • Positive control

    • WB: RT4 and U-251 MG whole cell lysates. IHC-P: Human duodenum tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab246865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 22 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Promotes cholesterol efflux from macrophage cells. Detected in HDL, LDL and VLDL. Secreted by a microsomal triglyceride transfer protein (MTTP)-dependent mechanism, probably as a VLDL-associated protein that is subsequently transferred to HDL. May be involved in myocardium-protective mechanisms against lipid accumulation.
  • Tissue specificity

    Expressed in all tissues examined. Up-regulated in diabetic heart.
  • Sequence similarities

    Belongs to the apolipoprotein O family.
  • Post-translational
    modifications

    O-glycosylation; glycosaminoglycan of chondroitin-sulfate type.
  • Cellular localization

    Membrane. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610008C08Rik antibody
    • 1110019O03Rik antibody
    • Apolipoprotein O antibody
    • APOO antibody
    • APOO_HUMAN antibody
    • FAM121B antibody
    • Family with sequence similarity 121B antibody
    • MGC130105 antibody
    • MGC130106 antibody
    • MGC4825 antibody
    • My025 antibody
    • MYO25 antibody
    • OTTHUMP00000023073 antibody
    • Protein FAM121B antibody
    • RP23-272D10.2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for Apolipoprotein O (green) using ab246865 at 4μg/ml in ICC/IF.

  • Paraffin-embedded human duodenum tissue stained for Apolipoprotein O using ab246865 at 1/20 dilution in immunohistochemical analysis.
  • All lanes : Anti-Apolipoprotein O antibody (ab246865) at 0.4 µg/ml

    Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate

    Predicted band size: 22 kDa

References

ab246865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up