Overview

  • Product name

  • Description

    Rabbit polyclonal to APP-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human APP-1 aa 381-435.
    Sequence:

    QYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQ MRPNP


    Database link: Q13310

  • Positive control

    • WB: RT-4 and U-251 MG cell lysate. ICC/IF: U-2 OS cells.
  • General notes

    Previously labelled as PABPC4. 

Properties

Applications

Our Abpromise guarantee covers the use of ab220832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 71 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Binds the poly(A) tail of mRNA. May be involved in cytoplasmic regulatory processes of mRNA metabolism. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.
  • Tissue specificity

    Expressed at low levels in resting normal T cells; following T-cell activation, however, mRNA levels are rapidly up-regulated.
  • Sequence similarities

    Belongs to the polyadenylate-binding protein type-1 family.
    Contains 1 PABC domain.
    Contains 4 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications

    Arg-518 is dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization

    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activated platelet protein 1 antibody
    • Activated-platelet protein 1 antibody
    • APP 1 antibody
    • APP-1 antibody
    • APP1 antibody
    • FLJ43938 antibody
    • Inducible poly(A) binding protein antibody
    • Inducible poly(A)-binding protein antibody
    • iPABP antibody
    • IPABP4 antibody
    • PABP 4 antibody
    • PABP-4 antibody
    • PABP4 antibody
    • PABP4_HUMAN antibody
    • PABPC 4 antibody
    • PABPC4 antibody
    • Poly A binding protein cytoplasmic 4 antibody
    • Poly(A) binding protein 4 antibody
    • Poly(A) binding protein cytoplasmic 4 (inducible form) antibody
    • Poly(A) binding protein cytoplasmic 4 antibody
    • Poly(A)-binding protein 4 antibody
    • Polyadenylate binding protein 4 antibody
    • Polyadenylate-binding protein 4 antibody
    • Polyadenylate-binding protein, cytoplasmic, 4 antibody
    • Polyadenylate-binding protein, inducible antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized U-2 OS cells labeling APP-1 with ab220832 at 4 µg/mL (green).

  • All lanes : Anti-APP-1 antibody (ab220832) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 71 kDa

References

This product has been referenced in:

  • Booy EP  et al. Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR. Nucleic Acids Res 46:11575-11591 (2018). Read more (PubMed: 30247708) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up