Overview

  • Product name

  • Description

    Rabbit polyclonal to APX2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Arabidopsis thaliana
  • Immunogen

    Recombinant fragment corresponding to Arabidopsis thaliana APX2 aa 4-250.
    Sequence:

    KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTK TGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGV VAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLND KDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLL QLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK


    Database link: Q1PER6

  • Positive control

    • WB: Arabidopsis thaliana lysate.
  • General notes

     This product was previously labelled as L-ascorbate peroxidase 2, L-ascorbate peroxidase 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab222414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/5000. Predicted molecular weight: 28 kDa.

Target

  • Function

    Plays a key role in hydrogen peroxide removal.
  • Tissue specificity

    Detected in bundle sheath cells, the photosynthetic cells that surround the phloem and xylem.
  • Sequence similarities

    Belongs to the peroxidase family. Ascorbate peroxidase subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

    • Alternative names

      • APX1b antibody
      • APX2 antibody
      • APX2_ARATH antibody
      • AtAPx02 antibody
      • cytosolic antibody
      • L-ascorbate peroxidase 1b antibody
      • L-ascorbate peroxidase 2 antibody
      see all

    Images

    • All lanes : Anti-APX2 antibody (ab222414) at 1/2000 dilution

      Lane 1 : Arabidopsis thaliana lysate at 40 µg
      Lane 2 : Arabidopsis thaliana lysate at 20 µg
      Lane 3 : Arabidopsis thaliana lysate at 10 µg
      Lane 4 : Arabidopsis thaliana lysate at 5 µg

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

      Predicted band size: 28 kDa

    References

    ab222414 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab222414.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up