Overview

  • Product name

    Anti-APX2 antibody (FITC)
    See all APX2 primary antibodies
  • Description

    Rabbit polyclonal to APX2 (FITC)
  • Host species

    Rabbit
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Arabidopsis thaliana
  • Immunogen

    Recombinant fragment corresponding to Arabidopsis thaliana APX2 aa 4-250.
    Sequence:

    KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTK TGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGV VAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLND KDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLL QLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK


    Database link: Q1PER6

  • General notes

     This product was previously labelled as L-ascorbate peroxidase 2, L-ascorbate peroxidase 2

     

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab192946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/600. Predicted molecular weight: 28 kDa.

Target

  • Function

    Plays a key role in hydrogen peroxide removal.
  • Tissue specificity

    Detected in bundle sheath cells, the photosynthetic cells that surround the phloem and xylem.
  • Sequence similarities

    Belongs to the peroxidase family. Ascorbate peroxidase subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

    • Alternative names

      • APX1b antibody
      • APX2 antibody
      • APX2_ARATH antibody
      • AtAPx02 antibody
      • cytosolic antibody
      • L-ascorbate peroxidase 1b antibody
      • L-ascorbate peroxidase 2 antibody
      see all

    References

    ab192946 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab192946.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up