Overview

  • Product name

    Anti-Aquaporin 2 antibody [7H8B5]
    See all Aquaporin 2 primary antibodies
  • Description

    Mouse monoclonal [7H8B5] to Aquaporin 2
  • Host species

    Mouse
  • Tested applications

    Suitable for: ELISA, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Aquaporin 2 aa 149-271. (Expressed in E.coli).
    Sequence:

    TDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKF DDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEE REVRRRQSVELHSPQSLPRGTKA


    Database link: P41181

  • Positive control

    • WB: K562, HeLa, HCT116 and SW480 cell lysate; Recombinant human Aquaporin 2 protein; AQP2-hIgGFc transfected HEK-293 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    7H8B5
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/10000.
WB 1/500 - 1/2000.

Target

  • Function

    Forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
  • Tissue specificity

    Expressed in renal collecting tubules.
  • Involvement in disease

    Diabetes insipidus, nephrogenic, autosomal
  • Sequence similarities

    Belongs to the MIP/aquaporin (TC 1.A.8) family.
  • Domain

    Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
  • Post-translational
    modifications

    Ser-256 phosphorylation is necessary and sufficient for expression at the apical membrane. Endocytosis is not phosphorylation-dependent.
  • Cellular localization

    Apical cell membrane. Basolateral cell membrane. Cytoplasmic vesicle membrane. Golgi apparatus, trans-Golgi network membrane. Shuttles from vesicles to the apical membrane. Vasopressin-regulated phosphorylation is required for translocation to the apical cell membrane. PLEKHA8/FAPP2 is required to transport AQP2 from the TGN to sites where AQP2 is phosphorylated.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADH water channel antibody
    • AQP 2 antibody
    • AQP CD antibody
    • AQP-2 antibody
    • AQP-CD antibody
    • AQP2 antibody
    • AQP2_HUMAN antibody
    • AQPCD antibody
    • Aquaporin 2 collecting duct antibody
    • Aquaporin CD antibody
    • Aquaporin-2 antibody
    • Aquaporin-CD antibody
    • Aquaporin2 antibody
    • Aquaporine 2 antibody
    • Collecting duct water channel protein antibody
    • MGC34501 antibody
    • Water channel aquaporin 2 antibody
    • Water channel protein for renal collecting duct antibody
    • WCH CD antibody
    • WCH-CD antibody
    • WCHCD antibody
    see all

Images

  • All lanes : Anti-Aquaporin 2 antibody [7H8B5] (ab233742) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : HCT116 (human colorectal carcinoma cell line) cell lysate
    Lane 4 : SW480 (Human colorectal adenocarcinoma cell line) cell lysate
  • All lanes : Anti-Aquaporin 2 antibody [7H8B5] (ab233742) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Aquaporine 2-hIgGFc transfected HEK-293 cell lysate.
  • Anti-Aquaporin 2 antibody [7H8B5] (ab233742) at 1/500 dilution + Recombinant human Aquaporin 2 protein

References

ab233742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up