Overview

  • Product name

  • Description

    Rabbit polyclonal to Arc
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Goat, Guinea pig, Cow, Human
  • Immunogen

    Synthetic peptide within Mouse Arc aa 101-150 (internal sequence). The exact sequence is proprietary.
    Sequence:

    TIANLERWVKREMHVWREVFYRLERWADRLESMGGKYPVGSEPARHTVSV


    Database link: NP_061260.1

  • Positive control

    • WB: Mouse brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab118929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration.
  • Sequence similarities

    Belongs to the ARC/ARG3.1 family.
  • Cellular localization

    Cytoplasm > cytoskeleton. Endosome. Cytoplasmic vesicle > secretory vesicle > acrosome. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell projection > dendrite. Cell projection > dendritic spine. Cell junction > synapse. Associated with the cell cortex of neuronal soma and dendrites. Enriched in postsynaptic density of dendritic spines. Associated with the sperm tail (By similarity). Enriched on the plasma membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • activity regulated cytoskeleton associated protein antibody
    • activity regulated gene 3.1 protein homolog antibody
    • Activity-regulated cytoskeleton-associated protein antibody
    • Activity-regulated gene 3.1 protein homolog antibody
    • Arc antibody
    • ARC/ARG3.1 antibody
    • ARC_HUMAN antibody
    • Arg 3.1 antibody
    • Arg3.1 antibody
    see all

Images

  • Anti-Arc antibody (ab118929) at 1 µg/ml + Mouse brain lysate at 10 µg

    Predicted band size: 45 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Block A  et al. The GABAAa5-selective Modulator, RO4938581, Rescues Protein Anomalies in the Ts65Dn Mouse Model of Down Syndrome. Neuroscience 372:192-212 (2018). Read more (PubMed: 29292072) »
  • Roy A  et al. Identification and characterization of PPARa ligands in the hippocampus. Nat Chem Biol 12:1075-1083 (2016). Read more (PubMed: 27748752) »
See all 6 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab118929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up