Overview

  • Product name
  • Description
    Mouse polyclonal to Arc
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Chimpanzee, Rhesus monkey, Gorilla
  • Immunogen

    Recombinant full length protein corresponding to Human Arc aa 1-396.
    Sequence:

    MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLL AEVSKQVERELKGLHRSVGKLESNLDGYVPTSDSQRWKKSIKACLCRCQE TIANLERWVKREMHVWREVFYRLERWADRLESTGGKYPVGSESARHTVSV GVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPG EDGQPSPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPA KKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQRELDLPQKQGEPLDQ FLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQ RGMEVQDDLEQAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE


    Database link: NP_056008.1

  • Positive control
    • WB: Arg 3.1 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab167305 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Function
    Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration.
  • Sequence similarities
    Belongs to the ARC/ARG3.1 family.
  • Cellular localization
    Cytoplasm > cytoskeleton. Endosome. Cytoplasmic vesicle > secretory vesicle > acrosome. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell projection > dendrite. Cell projection > dendritic spine. Cell junction > synapse. Associated with the cell cortex of neuronal soma and dendrites. Enriched in postsynaptic density of dendritic spines. Associated with the sperm tail (By similarity). Enriched on the plasma membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • activity regulated cytoskeleton associated protein antibody
    • activity regulated gene 3.1 protein homolog antibody
    • Activity-regulated cytoskeleton-associated protein antibody
    • Activity-regulated gene 3.1 protein homolog antibody
    • Arc antibody
    • ARC/ARG3.1 antibody
    • ARC_HUMAN antibody
    • Arg 3.1 antibody
    • Arg3.1 antibody
    see all

Images

  • All lanes : Anti-Arc antibody (ab167305) at 1 µg/ml

    Lane 1 : Arg 3.1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 45 kDa

References

ab167305 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167305.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up