Overview

  • Product name

  • Description

    Rabbit polyclonal to ARF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human ARF1 aa 2-181.
    Sequence:

    GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGF NVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVN EAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHR NWYIQATCATSGDGLYEGLDWLSNQLRNQK


    Database link: P84077

  • Positive control

    • IHC-P: Human small intestine and lung tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for ARF1 (Green) using ab236250 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human lung tissue stained for ARF1 with ab236250 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for ARF1 with ab236250 at a 1/100 dilution in immunohistochemical analysis.

References

ab236250 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236250.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up