Overview

  • Product name
  • Description
    Rabbit polyclonal to ARF4L
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human ARF4L.
    Sequence:

    GNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVP TKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVV DAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKR LAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKR


    Database link: P49703

  • Positive control
    • B16 (mouse melanoma) cell lysate and Human fetal kidney tissue.

Properties

  • Form
    Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 1% BSA, 98% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169925 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/500 - 1/1000. Predicted molecular weight: 22 kDa.

Target

  • Function
    Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Arf family.
  • Cellular localization
    Nucleus > nucleolus. Cell membrane. Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • ADP ribosylation factor 4 like antibody
    • ADP ribosylation factor like 4D antibody
    • ADP ribosylation factor like 6 antibody
    • ADP ribosylation factor like protein 4D antibody
    • ADP ribosylation factor like protein 4L antibody
    • ADP-ribosylation factor-like protein 4D antibody
    • ADP-ribosylation factor-like protein 4L antibody
    • AR L6 antibody
    • ARF 4L antibody
    • ARF4L antibody
    • ARL 4D antibody
    • ARL 6 antibody
    • ARL4D antibody
    • ARL4D_HUMAN antibody
    • ARL6 antibody
    see all

Images

  • Anti-ARF4L antibody (ab169925) at 1/500 dilution + B16 (Mouse melanoma) cell lysate

    Predicted band size: 22 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal kidney tissue, labelling ARF4L with ab169925 at 1/100 dilution.

References

ab169925 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169925.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up