Overview

  • Product name

    Anti-ARFGAP1 antibody [1C4E2]
    See all ARFGAP1 primary antibodies
  • Description

    Mouse monoclonal [1C4E2] to ARFGAP1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ARFGAP1 aa 270-414. Expressed in E. coli.
    Sequence:

    KEGKIFDDVSSGVSQLASKGVGSKGWRDVTTFFSGKAEGPLDSPSEGHSY QNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRSS DSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW


    Database link: Q8N6T3-2

  • Positive control

    • WB: MOLT-4, C2C12, HepG2, MCF7 and LNcap cell lysate; ARFGAP1 (amino acids: 270-414)-hIgGFc transfected HEK-293 cell lysate; Recombinant human ARFGAP1 (amino acids: 270-414) protein. Flow Cytometry: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 45 kDa.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles, a prerequisite for vesicle's fusion with target compartment. Probably regulates ARF1-mediated transport via its interaction with the KDELR proteins and RNP24. Overexpression induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, as when ARF1 is deactivated. Its activity is stimulated by phosphoinosides and inhibited by phosphatidylcholine.
  • Sequence similarities

    Contains 1 Arf-GAP domain.
  • Domain

    The region downstream of Arf-GAP domain is essential to GAP activity in vivo. This region may be required for its targeting to Golgi membranes.
  • Cellular localization

    Cytoplasm. Golgi apparatus. Associates with the Golgi complex.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADP ribosylation factor 1 GTPase activating protein antibody
    • ADP ribosylation factor GTPase activating protein 1 antibody
    • ADP-ribosylation factor 1 GTPase-activating protein antibody
    • ADP-ribosylation factor GTPase-activating protein 1 antibody
    • ARF GAP 1 antibody
    • ARF1 directed GTPase activating protein antibody
    • ARF1 GAP antibody
    • ARF1-directed GTPase-activating protein antibody
    • ARF1GAP antibody
    • ARFG1_HUMAN antibody
    • Arfgap1 antibody
    • GAP protein antibody
    • HRIHFB2281 antibody
    see all

Images

  • All lanes : Anti-ARFGAP1 antibody [1C4E2] (ab234087) at 1/100 dilution

    Lane 1 : MOLT-4 (human lymphoblastic leukemia cell line) cell lysate
    Lane 2 : C2C12 (mouse myoblast cell line) cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 4 : MCF7 (human breast adenocarcinoma cell line) cell lysate
    Lane 5 : LNCap (human prostate cancer cell line) cell lysate

    Predicted band size: 45 kDa

  • Flow Cytometry analysis of HepG2 (human liver hepatocellular carcinoma cell line) cells, labeling ARFGAP1 with ab234087 at 1/200 dilution (green) compared to a negative control (red).

  • All lanes : Anti-ARFGAP1 antibody [1C4E2] (ab234087) at 1/100 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : ARFGAP1 (amino acids: 270-414)-hIgGFc transfected HEK-293 cell lysate

    Predicted band size: 45 kDa

  • Anti-ARFGAP1 antibody [1C4E2] (ab234087) at 1/100 dilution + Recombinant human ARFGAP1 (amino acids: 270-414) protein

    Predicted band size: 45 kDa



    Expected recombinant MW is 41.5 kDa

References

ab234087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up