Overview

  • Product name

  • Description

    Rabbit polyclonal to ARFGAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ARFGAP1 aa 141-243.
    Sequence:

    TLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTP PPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQ KASEL


    Database link: Q8N6T3

  • Positive control

    • Human cervix uterine tissue; CACO-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 45 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles, a prerequisite for vesicle's fusion with target compartment. Probably regulates ARF1-mediated transport via its interaction with the KDELR proteins and RNP24. Overexpression induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, as when ARF1 is deactivated. Its activity is stimulated by phosphoinosides and inhibited by phosphatidylcholine.
  • Sequence similarities

    Contains 1 Arf-GAP domain.
  • Domain

    The region downstream of Arf-GAP domain is essential to GAP activity in vivo. This region may be required for its targeting to Golgi membranes.
  • Cellular localization

    Cytoplasm. Golgi apparatus. Associates with the Golgi complex.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADP ribosylation factor 1 GTPase activating protein antibody
    • ADP ribosylation factor GTPase activating protein 1 antibody
    • ADP-ribosylation factor 1 GTPase-activating protein antibody
    • ADP-ribosylation factor GTPase-activating protein 1 antibody
    • ARF GAP 1 antibody
    • ARF1 directed GTPase activating protein antibody
    • ARF1 GAP antibody
    • ARF1-directed GTPase-activating protein antibody
    • ARF1GAP antibody
    • ARFG1_HUMAN antibody
    • Arfgap1 antibody
    • GAP protein antibody
    • HRIHFB2281 antibody
    see all

Images

  • Immunofluorescent analysis of CACO-2 cells labeling ARFGAP1 with ab204405 at 4 µg/mL. Fixation/Permeabilization: PFA/Triton X-100.

  • Immunohistochemical analysis of paraffin-embedded Human cervix uterine tissue labeling ARFGAP1 with ab204405 at 1/1000 dilution.

References

ab204405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up