Overview

  • Product name

    Anti-ARFGEF2/BIG2 antibody
    See all ARFGEF2/BIG2 primary antibodies
  • Description

    Rabbit polyclonal to ARFGEF2/BIG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human ARFGEF2/BIG2 aa 200-317.
    Sequence:

    QVLQEARELEKPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTD LTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTS AIKEAAEKHGLTEPERVL


    Database link: Q9Y6D5

  • Positive control

    • IHC-P: Human breast cancer and pancreatic cancer tissue. ICC/IF: A549 cells. WB: Rat heart, Mouse brain, and Mouse liver tissue lysate
  • General notes

     This product was previously labelled as ARFGEF2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 3.2 µg/ml. Predicted molecular weight: 202 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. ARFGEF2 promotes guanine-nucleotide exchange on ARF1, ARF5 and ARF6 and the activation of ARF1/ARF5/ARF6 through replacement of GDP with GTP. It contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition.
  • Cellular localization

    Cytoplasm. Membrane. Golgi apparatus. Cytoplasm › perinuclear region. Golgi apparatus › trans-Golgi network By similarity. Endosome By similarity. Cytoplasm › cytoskeleton › microtubule organizing center › centrosome. Cell projection › dendrite By similarity. Cytoplasmic vesicle By similarity. Cell junction › synapse By similarity. Cytoplasm › cytoskeleton By similarity. Note: Translocates from cytoplasm to membranes upon cAMP treatment. Localized in recycling endosomes.
  • Database links

  • Alternative names

    • ADP ribosylation factor guanine nucleotide exchange factor 2 (brefeldin A inhibited) antibody
    • ADP ribosylation factor guanine nucleotide exchange factor 2 antibody
    • ARFGEF 2 antibody
    • ARFGEF2 antibody
    • ARFGEP2 antibody
    • BIG 2 antibody
    • BIG2 antibody
    • Brefeldin A inhibited 2 antibody
    • Brefeldin A inhibited GEP 2 antibody
    • Brefeldin A inhibited guanine nucleotide exchange protein 2 antibody
    • dJ1164I10.1 antibody
    • FLJ23723 antibody
    see all

Images

  • All lanes : Anti-ARFGEF2/BIG2 antibody (ab236951) at 3.2 µg/ml

    Lane 1 : Rat heart tissue
    Lane 2 : Mouse brain tissue
    Lane 3 : Mouse liver tissue

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 202 kDa

  • A549 (Human lung carcinoma cell line) cells stained for ARFGEF2/BIG2 using ab236951 at a dilution of 1/133 in ICC/IF.
    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). COunterstained with DAPI (blue).

  • Paraffin-embedded human breast cancer tissue stained for ARFGEF2/BIG2 with ab236951 at a 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human pancreatic cancer tissue stained for ARFGEF2/BIG with ab236951 at a 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up