Overview

  • Product name

    Anti-Arginine kinase antibody
  • Description

    Rabbit polyclonal to Arginine kinase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Giant tiger prawn, Kuruma prawn, Callinectes sapidus, Marbled crab, Chinese mitten crab, Shore crab, Common lobster
  • Immunogen

    Recombinant full length protein corresponding to Giant tiger prawn Arginine kinase aa 2-356.
    Sequence:

    ADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLL DVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPN KDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAK VSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANAC RYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVN EIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVA GKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIK MEKEM


    Database link: C7E3T4

  • Positive control

    • WB: Recombinant protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225937 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 56 kDa (predicted molecular weight: 56 kDa).

Images

  • All lanes : Anti-Arginine kinase antibody (ab225937) at 1/500 dilution

    Lane 1 : Recombinant protein at 0.06 µg
    Lane 2 : Recombinant protein at 0.03 µg
    Lane 3 : Recombinant protein 15 ng at 0.015 µg
    Lane 4 : Recombinant protein at 0.0075 µg

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Predicted band size: 56 kDa
    Observed band size: 56 kDa

References

ab225937 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225937.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up