Overview

  • Product name

  • Description

    Rabbit polyclonal to ARHGAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human ARHGAP1 aa 17-138.
    Sequence:

    SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYD IARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYV ESDYTLLYLHHGLTSDNKPSLS


    Database link: Q07960

  • Positive control

    • WB: MCF7, NIH/3T3 and NBT-II cell lysates; human cerebral cotex tissue lysate; mouse cerebral cortex tissue lysate. IHC-P: Mouse dentate gyrus, cingulate cortex, thalamus, motor trigeminal nucleus and paragigantocellular nucleus tissue; human hippocampus and stomach tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 50 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100

Target

  • Function

    GTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively inactive GDP-bound state. Cdc42 seems to be the preferred substrate.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 CRAL-TRIO domain.
    Contains 1 Rho-GAP domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHGAP 1 antibody
    • Arhgap1 antibody
    • CDC42 GTPase activating protein antibody
    • Cdc42 GTPase-activating protein antibody
    • CDC42GAP antibody
    • GTPase activating protein rhoOGAP antibody
    • GTPase-activating protein rhoOGAP antibody
    • GTPase-activating protein, Rho, 1 antibody
    • OTTHUMP00000233485 antibody
    • OTTHUMP00000233486 antibody
    • p50 RhoGAP antibody
    • p50-RhoGAP antibody
    • p50rhoGAP antibody
    • RHG01_HUMAN antibody
    • Rho GTPase activating protein 1 antibody
    • Rho GTPase-activating protein 1 antibody
    • Rho related small GTPase protein activator antibody
    • Rho type GTPase activating protein 1 antibody
    • Rho-related small GTPase protein activator antibody
    • Rho-type GTPase-activating protein 1 antibody
    • RHOGAP antibody
    • RHOGAP1 antibody
    see all

Images

  • Anti-ARHGAP1 antibody (ab224231) at 100 cells + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 50 kDa

  • Paraffin-embedded mouse dentate gyrus stained for ARHGAP1 with ab224231 (1/50) in immunohistochemical analysis.

  • Paraffin-embedded human hippocampus tissue stained for ARHGAP1 with ab224231 (1/50) in immunohistochemical analysis.

  • Paraffin-embedded mouse cingulate cortex nucleus stained for ARHGAP1 with ab224231 (1/50) in immunohistochemical analysis.

  • Paraffin-embedded mouse thalamus stained for ARHGAP1 with ab224231 (1/50) in immunohistochemical analysis.

  • Paraffin-embedded mouse motor trigeminal nucleus stained for ARHGAP1 with ab224231 (1/50) in immunohistochemical analysis.

  • Paraffin-embedded mouse brain tissue stained for ARHGAP1 with ab224231 (1/50) in immunohistochemical analysis.

  • Paraffin-embedded human stomach tissue stained for ARHGAP1 with ab224231 (1/50) in immunohistochemical analysis.

  • Anti-ARHGAP1 antibody (ab224231) at 1/100 dilution + Mouse cerebral cortex lysate

    Predicted band size: 50 kDa

  • All lanes : Anti-ARHGAP1 antibody (ab224231) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat cell line) cell lysate

    Predicted band size: 50 kDa

  • Anti-ARHGAP1 antibody (ab224231) at 1/100 dilution + Human cerebral cortex lysate

    Predicted band size: 50 kDa

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for ARHGAP1 (green) using ab224231 (4 µg/ml) in ICC/IF.

References

ab224231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up