Overview

  • Product name

    Anti-ARHGAP10 antibody
  • Description

    Rabbit polyclonal to ARHGAP10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ARHGAP10 aa 542-744.
    Sequence:

    LMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSAS PPNAPPRQSKRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSL SSPSPVTTAVPGPPGPDKNHLLADGGSFGDWASTIPGQTRSSMVQWLNPQ SPTTTSSNSAVTPLSPGSSPFPFSPPATVADKPPESIRSRKARAVYPCEA EHS


    Database link: A1A4S6

  • Positive control

    • IHC-P: Human lung cancer tissue. ICC/IF: HepG2 (human liver hepatocellular carcinoma cell line) cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab222805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    GTPase activator for the small GTPases RhoA and Cdc42 by converting them to an inactive GDP-bound state. Essential for PTKB2 regulation of cytoskeletal organization via Rho family GTPases. Inhibits PAK2 proteolytic fragment PAK-2p34 kinase activity and changes its localization from the nucleus to the perinuclear region. Stabilizes PAK-2p34 thereby increasing stimulation of cell death.
  • Tissue specificity

    High levels of expression in heart and skeletal muscle.
  • Sequence similarities

    Contains 1 BAR domain.
    Contains 1 PH domain.
    Contains 1 Rho-GAP domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylated in vitro by constitutive active PKN3.
  • Cellular localization

    Cytoplasm. Cytoplasm > perinuclear region. Cell membrane. Association to cell membrane is dependent on PH domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Arhgap10 antibody
    • Graf-related protein 2 antibody
    • GRAF2 antibody
    • GTPase regulator associated with focal adhesion kinase 2 antibody
    • PS GAP antibody
    • PSGAP antibody
    • RHG10_HUMAN antibody
    • Rho GTPase-activating protein 10 antibody
    • Rho-type GTPase-activating protein 10 antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for ARHGAP10 using ab222805 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ARHGAP10 (green) using ab222805 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab222805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up