Overview

  • Product name

    Anti-ARHGAP42 antibody [2F1A7]
    See all ARHGAP42 primary antibodies
  • Description

    Mouse monoclonal [2F1A7] to ARHGAP42
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ARHGAP42 aa 577-719. (Expressed in E.coli).
    Sequence:

    DPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSP DSTPMGSIESLSSHSSEQNSTTKSASCQPREKSGGIPWIATPSSSNGQKS LGLWTTSPESSSREDATKTDAESDCQSVASVTSPGDVSPPIDL


    Database link: A6NI28

  • Positive control

    • Recombinant human ARHGAP42 (aa: 577-719) protein; ARHGAP42 (aa: 577-719)-hIgGFc transfected HEK-293T cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    2F1A7
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500.

Target

  • Function

    May act as a GTPase activator.
  • Sequence similarities

    Contains 1 BAR domain.
    Contains 1 PH domain.
    Contains 1 Rho-GAP domain.
    Contains 1 SH3 domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHGAP42 antibody
    • FLJ32810 antibody
    • GRAF3 antibody
    • RHG42_HUMAN antibody
    • Rho GTPase-activating protein 10-like antibody
    • Rho GTPase-activating protein 42 antibody
    • Rho-type GTPase-activating protein 42 antibody
    see all

Images

  • All lanes : Anti-ARHGAP42 antibody [2F1A7] (ab234078) at 1/100 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : ARHGAP42 (aa: 577-719)-hIgGFc transfected HEK-293T cell lysate
  • Anti-ARHGAP42 antibody [2F1A7] (ab234078) at 1/100 dilution + Recombinant human ARHGAP42 protein


    Expected MW is 41.1 kDa.

References

ab234078 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up