Overview

  • Product name

  • Description

    Rabbit polyclonal to ARHGAP42
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ARHGAP42 aa 541-728.
    Sequence:

    MRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSG SRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSH SSEQNSTTKSASCQPREKSGGIPWIATPSSSNGQKSLGLWTTSPESSSRE DATKTDAESDCQSVASVTSPGDVSPPIDLVKKEPYGLS


    Database link: A6NI28

  • Positive control

    • WB: Human placenta lysate. IHC-P: Human testis and brain tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Detects a band of approximately 99 kDa (predicted molecular weight: 99 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-ARHGAP42 antibody (ab222815) at 1/2000 dilution + Human placenta lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 99 kDa
    Observed band size: 99 kDa

  • Paraffin-embedded human brain tissue stained for ARHGAP42 using ab222815 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for ARHGAP42 using ab222815 at 1/100 dilution in immunohistochemical analysis.

References

ab222815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up