Overview

  • Product name

    Anti-Arhgap5 antibody
  • Description

    Rabbit polyclonal to Arhgap5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Fusion protein corresponding to Human Arhgap5 aa 1-237. The identity of the protein fusion partner is GST. BC075799.
    Sequence:

    MSLPPPPPGPLPLRRRRRRPTLLGLCTEGLYRVSGNKTDQDNIQKQFDQD HNINLVSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTE RLHALKEIVKKFHPVNYDVFRYVITHLNRVSQQHKINLMTADNLSICFWP TLMRPDFENREFLSTTKIHQSVVETFIQQCQFFFYNGEIVETTNIVAPPP PSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPLGII


    Database link: Q13017-3

  • Positive control

    • Human thyroid cancer and Human liver cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab199160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/25 - 1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    GTPase-activating protein for Rho family members. May play a role in the reduction of the p21rasGTPase-activating potential of RASA1/p120GAP.
  • Tissue specificity

    Expressed in kidney, brain, liver and lung.
  • Sequence similarities

    Contains 4 FF domains.
    Contains 1 Rho-GAP domain.
  • Cellular localization

    Cytoplasm. Membrane. Also membrane-associated when found in fibrillar patterns that colocalize with the alpha5-beta1 integrin receptor (ITGA5/ITGB1) for fibronectin.
  • Information by UniProt
  • Database links

  • Alternative names

    • Arhgap5 antibody
    • p190-B antibody
    • RHG05_HUMAN antibody
    • Rho GTPase activating protein 5 antibody
    • Rho GTPase-activating protein 5 antibody
    • Rho-type GTPase-activating protein 5 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue labeling Arhgap5 with ab199160 at 1/25 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling Arhgap5 with ab199160 at 1/25 dilution.

References

ab199160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry
Sample
Mouse Cultured Cells (GT1-7 cells)
Permeabilization
Yes - PBST
Specification
GT1-7 cells
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Mar 22 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up