Overview

  • Product name

  • Description

    Rabbit polyclonal to ARHGDIG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ARHGDIG aa 1-225.
    Sequence:

    MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRA PGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLS EQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCL HHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVS LFTDDDRTHHLSWEWGLCICQDWKD


    Database link: Q99819

  • Positive control

    • WB: Mouse brain and lung tissue lysates. IHC-P: Human brain and placenta tissue. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity > 95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 25, 50 kDa (predicted molecular weight: 25 kDa).

Target

  • Function

    Inhibits GDP/GTP exchange reaction of RhoB. Interacts specifically with the GDP- and GTP-bound forms of post-translationally processed Rhob and Rhog proteins, both of which show a growth-regulated expression in mammalian cells. Stimulates the release of the GDP-bound but not the GTP-bound RhoB protein. Also inhibits the GDP/GTP exchange of RhoB but shows less ability to inhibit the dissociation of prebound GTP.
  • Tissue specificity

    Primarily expressed in pancreas and brain.
  • Sequence similarities

    Belongs to the Rho GDI family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Arhgdig antibody
    • GDIR3_HUMAN antibody
    • OTTHUMP00000067353 antibody
    • OTTHUMP00000194914 antibody
    • Rho GDI 3 antibody
    • Rho GDI gamma antibody
    • Rho GDP dissociation inhibitor (GDI) gamma antibody
    • Rho GDP dissociation inhibitor 3 antibody
    • Rho GDP dissociation inhibitor gamma antibody
    • Rho GDP-dissociation inhibitor 3 antibody
    • Rho-GDI gamma antibody
    • RHOGDI 3 antibody
    • RhoGDI gamma antibody
    • RHOGDI3 antibody
    see all

Images

  • All lanes : Anti-ARHGDIG antibody (ab223058) at 1/1000 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse lung lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/10000 dilution

    Predicted band size: 25 kDa

  • Paraffin embedded human brain tissue stained for ARHGDIG with ab223058 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin embedded human placenta tissue stained for ARHGDIG with ab223058 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for ARHGDIG (green) using ab223058 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab223058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up