Overview

  • Product name

  • Description

    Rabbit polyclonal to ARHGEF14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ARHGEF14 aa 850-980.
    Sequence:

    KELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMAAV GITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQ ACREASQHRALEQSQSLPLPAPTSTSPSRGN


    Database link: O15068

  • Positive control

    • IHC-P: Human tonsil and spleen tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Guanine nucleotide exchange factor that potentially links pathways that signal through RAC1, RHOA and CDC42. Catalyzes guanine nucleotide exchange on RHOA and CDC42 and interacts specifically with the GTP-bound form of RAC1, suggesting that it functions as an effector of RAC1. May also participate in axonal transport in the brain. Becomes activated and highly tumorigenic by truncation of the N-terminus (By similarity). Isoform 5 activates CDC42.
  • Sequence similarities

    Belongs to the MCF2 family.
    Contains 1 CRAL-TRIO domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
    Contains 1 spectrin repeat.
  • Domain

    The CRAL-TRIO domain is involved in interaction with inositol phospholipids.
    The DH domain is involved in interaction with CCPG1.
  • Cellular localization

    Cytoplasm. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHGEF 14 antibody
    • DBL''s big sister antibody
    • DBS antibody
    • FLJ12122 antibody
    • Guanine nucleotide exchange factor DBS antibody
    • KIAA0362 antibody
    • MCF 2L antibody
    • MCF.2 cell line derived transforming sequence like antibody
    • MCF.2 transforming sequence-like antibody
    • MCF2 like protein antibody
    • MCF2 transforming sequence like protein antibody
    • MCF2-transforming sequence-like protein antibody
    • Mcf2l antibody
    • MCF2L_HUMAN antibody
    • OST antibody
    • OST oncogene antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for ARHGEF14 using ab230266 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human spleen tissue stained for ARHGEF14 using ab230266 at 1/100 dilution in immunohistochemical analysis.

References

ab230266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up